Dataset for protein BAX-like of organism Cynoglossus semilaevis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8VGS5_BOK-01      MEMLRRSSVFAAE---VFDRSPTDKELVSQAKALCRDYINSRLNRV---G
A0A3P8WH41_BOK-01      MEVLRRSSVFAAEVLDVFDRSLTEKDLVSQSKALCRDYILFRLNQN---G
A0A3P8X0F2_BAX-01      ----------MAAHPGGDDDGTNRDQLLELGRILLKDFIYERVQRNRDSN
                                  *      * . . .:*:. .. * .*:*  *::.    .

A0A3P8VGS5_BOK-01      MGWTSPEHGLAS-SSGTMREISSVLLWLGDELEYLRPNVYRNVARQLNIT
A0A3P8WH41_BOK-01      LGWSKSELNLVP-SNAALAEVSSVLLCLGDELECLQPSLYRNVARQLSIS
A0A3P8X0F2_BAX-01      AVVTRSQLGAGELCDPNHKKLAQCLQQIGDELD-------GNVELQRMIE
                          : .: .    ..    :::. *  :****:        **  *  * 

A0A3P8VGS5_BOK-01      VASESVVSDAFLAVAADIFSTG-ITWGKVVSLYAVAGALAVDCVRHGHPS
A0A3P8WH41_BOK-01      VAMENMVSDAFIGVSTEIFATG-ITWGKVVAMYAVAAALAVDCVRQDRAA
A0A3P8X0F2_BAX-01      NSSLSPTREVFMRVAYEIFSDGKFNWGRVVALFYFACRLVIKALVTQVPD
                        :  . . :.*: *: :**: * :.**.**::: .*  *.:..:    . 

A0A3P8VGS5_BOK-01      IVHTIVDCMGEFVRKSLTSWLKKRGGWMDVTKCVVNTDPRFSSHWLVMAA
A0A3P8WH41_BOK-01      NVNIIVQSLGQFVRKFLVSWLKRRGGWGDITKCVVKKDFPPEQNWLTSVM
A0A3P8X0F2_BAX-01      IIRTIINWTVDYLRENVINWIMEQGGWEGIRSYFGTPTWQTVGVFLAGVL
                        :. *::   :::*: : .*:  .*** .: . . .        :*. . 

A0A3P8VGS5_BOK-01      CTFGHYVKTIVLYLLREK
A0A3P8WH41_BOK-01      ESLKYFLTTVYVYIMKEP
A0A3P8X0F2_BAX-01      TT---------VIVIRKM
                        :         : ::.: 

© 1998-2019