Dataset for protein BAX-like of organism Crassostrea hongkongensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0C5DGQ6_BAX-01       ---------------MTSSDSFRPFVKEPSGVTRQLSKDEVGQQARVLLL
A0A0C5DYM0_BAK1-01      MAYWDGGSGTRGGGRVPPSSDVRQIPSPSEQMTPDTEENVIDEAEDV--I
                                       :..*...* : . .. :* : .:: :.:   *  :

A0A0C5DGQ6_BAX-01       NQFIQDRLATERSEEQVLHMEDLQDPGTP-----TGPPLEYVREIGRALR
A0A0C5DYM0_BAK1-01      RNFIFESYQHQLTEE--VDTLDSTTPQVPELCAFTSDPMSRASQVGRQLA
                        .:** :    : :**  :   *   * .*     *. *:. . ::** * 

A0A0C5DGQ6_BAX-01       CIGDELDRN--EQIQNLCDQ--VNPSANHETFFNVANSFFADGVYNWGRV
A0A0C5DYM0_BAK1-01      RIGDDINRRYADEFKDMINQLNVNEDTAYEVFAGVAKKLFADEI-NWGRV
                         ***:::*.  :::::: :*  ** .: :*.* .**:.:*** : *****

A0A0C5DGQ6_BAX-01       GCLFYFAYKMAVKALSK-----INLIRSIVNWVVNFITDYVAGWIIDRGG
A0A0C5DYM0_BAK1-01      AALMCLAYRITMTVVKEKAKKFAQFMKVIVSHVVRFIKEKIAGWIASQGG
                        ..*: :**.:::..:.:      :::. **..**.**.: :**** ..**

A0A0C5DGQ6_BAX-01       WDAIIEYFGTPQNQFFG---VVGLGLTVCAGLYLLKALK
A0A0C5DYM0_BAK1-01      WSAALQY--SPSMSFTSLSIVVGSCLAAIAAVFYFSKKS
                        *.* ::*  :*. .* .   ***  *:. *.:: :.  .

© 1998-2019