Dataset for protein BAX-like of organism Crassostrea gigas

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K1P6Q7_BAK1-01      MAESKKTELEIHREMMTLLSHLRENKTRVRKKVPMAQTSKQEIKADVRKILEQFLKKQQL
K1RL21_BAX-01       ------------------------------------------------------------
                                                                                

K1P6Q7_BAK1-01      NDDEEEGAIPTGFQREDVENVTETYRSGSTNTSWEEYECLRCEAGCRSKVIKSIPTCSNR
K1RL21_BAX-01       MEDLQDPGTPTG------------------------------------------------
                     :* :: . ***                                                

K1P6Q7_BAK1-01      SPTDDTTNFTFIDEYEHDVERSHKDHSESVNKRGDVVQNVHTHKISHVEQHNYTNGNKSG
K1RL21_BAX-01       ------------------------------------------------------------
                                                                                

K1P6Q7_BAK1-01      MLMESEVWECKDLAGKSEHKHGERHSNIRETMRPRHATSGRTSSEKDRLYTAVAEKLAHI
K1RL21_BAX-01       ------------------------------------------------------------
                                                                                

K1P6Q7_BAK1-01      GDHYKATSPLSDSTRSSVDNTATRRASARTPNLPGVDERGSDGLTALERQLIDSLREVGD
K1RL21_BAX-01       ------------------------------------------------------------
                                                                                

K1P6Q7_BAK1-01      SFQLKLSPNAVKEIVKQAMYQRFQEVVDKKTGPGNSWDHIAAVFYLTKKVVTMAGVGRAV
K1RL21_BAX-01       ------------------------------------------------------------
                                                                                

K1P6Q7_BAK1-01      ALQVKDLAAEYVADKFATWIVDQGGWGDLGQMAYWDGGSGTRGGGRVPPSSDVRQIPSPS
K1RL21_BAX-01       ------------------------------------------------------------
                                                                                

K1P6Q7_BAK1-01      EQMTPDTEENVIDEAEDVIRNFIFESYQHQLVEEVDTLDSTTPQVPELCAFTSDPMSRAS
K1RL21_BAX-01       -----------------------------------------------------PPLEYVR
                                                                          *:. . 

K1P6Q7_BAK1-01      QVGRQLARIGDDINRRYADEFKDMINQLNVNEDTAYEVFAGVAKKLFADEI-NWGRVAAL
K1RL21_BAX-01       EIGRALRCIGDELDRN--EQIQNLVDQ--VTPSANHETFFNVANSFFSDGVYNWGRVGCL
                    ::** *  ***:::*.  ::::::::*  *. .: :*.* .**:.:*:* : *****..*

K1P6Q7_BAK1-01      MCLAYRITMTVVKEKAKKFAQFMKVIVSHVVRFIKEKIAGWIASQGGWSAALQY--SPSM
K1RL21_BAX-01       FYFAYKMAVKALSK-----INLIRSIVNWVVNFITDYVAGWIIDRGGWDAIIEYFGTPQN
                    : :**.:::..:.:      :::. **..**.**.: :**** ..***.* ::*  :*. 

K1P6Q7_BAK1-01      SFTSLSIVVGSCVAAIAAVFYFSKKS
K1RL21_BAX-01       QFFG---VVGLGITVCAGLYLWKALK
                    .* .   ***  ::. *.:: :.  .

© 1998-2019