Dataset for protein BAX-like of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5JHM2_BAX-02       -MDGSGEQPRGGGP--------------TSSEQIMKTG------------
A0A2K5IYH0_BAK1-02      MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAE
A0A2K5IYH0_BAK1-01      MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAE
A0A2K5I0T0_BOK-01       -PTGCPHCLQGLDC--------------RGWDQ-----------------
A0A2K5JHM2_BAX-03       -MDGSGEQPRGGVS--------------SRIEQ-----------------
A0A2K5JHM2_BAX-05       -MDGSGEQPRGGGP--------------TSSEQIMKTGALLLQGFIQDRA
A0A2K5JHM2_BAX-04       -MDGSGEQPRGGGV--------------TPRSDSAPS--------LHPHS
A0A2K5JHM2_BAX-01       -MDGSGEQPRGGGP--------------TSSEQIMKTGALLLQGFIQDRA
                           *                           .:                 

A0A2K5JHM2_BAX-02       ---------------------------------------ALLLQGMIAAV
A0A2K5IYH0_BAK1-02      GAAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL
A0A2K5IYH0_BAK1-01      GAAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL
A0A2K5I0T0_BOK-01       --------PLCVCPVPSPQLGCR--DELEMIRPSVYR--NVARQLHISLQ
A0A2K5JHM2_BAX-03       ------GEWLALDPVPQDASTKRLSECLKRIGDELDS--NMELQRMIAAV
A0A2K5JHM2_BAX-05       GRMGGETPELALDPVPQDASTKRLSECLKRIGDELDS--NMELQRMIAAV
A0A2K5JHM2_BAX-04       RRMGGETPELALDPVPQDASTKRLSECLKRIGDELDS--NMELQRMIAAV
A0A2K5JHM2_BAX-01       GRMGGETPELALDPVPQDASTKRLSECLKRIGDELDS--NMELQRMIAAV
                                                                   *  :   

A0A2K5JHM2_BAX-02       D--TDSPREVFFRVAA----------DMFSDGNFNWGRVVALFYFASKLV
A0A2K5IYH0_BAK1-02      QPTAENAYEYFTKIASRPAATPTACLRVASTG-AVW--------------
A0A2K5IYH0_BAK1-01      QPTAENAYEYFTKIAS----------SLFESG-INWGRVVALLGFGYRLA
A0A2K5I0T0_BOK-01       S--EPVVTDAFLAVAG----------HIFSAG-ITWGKVVSLYAVAAGLA
A0A2K5JHM2_BAX-03       D--TDSPREVFFRVAA----------DMFSDGNFNWGRVVALFYFASKLV
A0A2K5JHM2_BAX-05       D--TDSPREVFFRVAA----------DMFSDGNFNWGRVVALFYFASKLV
A0A2K5JHM2_BAX-04       D--TDSPREVFFRVAA----------DMFSDGNFNWGRVVALFYFASKLV
A0A2K5JHM2_BAX-01       D--TDSPREVFFRVAA----------DMFSDGNFNWGRVVALFYFASKLV
                        .       : *  :*.           : . *   *              

A0A2K5JHM2_BAX-02       LKALCTKVPELIRTIMGWTLDFL-RERLLGWIQDQGGWDGLL-----SYF
A0A2K5IYH0_BAK1-02      ---------------------WLFWASATVW----------------PYT
A0A2K5IYH0_BAK1-01      LHVYQRGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPIL
A0A2K5I0T0_BOK-01       VDCVRQAQPAMVHALVDCLGEFV-RKTLATWLRRRGGWTDVLKCVVSTDP
A0A2K5JHM2_BAX-03       LKALCTKVPELIRTIMGWTLDFL-RERLLGWIQDQGGWGLPLAESLKRLL
A0A2K5JHM2_BAX-05       LKALCTKVPELIRTIMGWTLDFL-RERLLGWIQDQGGWVRLLNPPHPNHR
A0A2K5JHM2_BAX-04       LKALCTKVPELIRTIMGWTLDFL-RERLLGWIQDQGGWDGLL-----SYF
A0A2K5JHM2_BAX-01       LKALCTKVPELIRTIMGWTLDFL-RERLLGWIQDQGGWDGLL-----SYF
                                             :: .     *                   

A0A2K5JHM2_BAX-02       GTPTWQTVTIL----------VAGVLTASLTIWKKMG-------------
A0A2K5IYH0_BAK1-02      STSAA---------------------------------------------
A0A2K5IYH0_BAK1-01      NVLVVLGVVLL-----------------------------GQFVVRRFFK
A0A2K5I0T0_BOK-01       GLRSHWLVAAL--------CSFGRFLKAAFFVLLPER-------------
A0A2K5JHM2_BAX-03       SLSPGRPPLLLWDAHVADRDHLGGWSTHCLAHHLEEDGLRPPAALNCVFP
A0A2K5JHM2_BAX-05       PCPTVPWCPLP----------IFGSSDVVYNAFPYVS-------------
A0A2K5JHM2_BAX-04       GTPTWQTVTIL----------VAGVLTASLTIWKKMG-------------
A0A2K5JHM2_BAX-01       GTPTWQTVTIL----------VAGVLTASLTIWKKMG-------------
                                                                          

A0A2K5JHM2_BAX-02       -
A0A2K5IYH0_BAK1-02      -
A0A2K5IYH0_BAK1-01      S
A0A2K5I0T0_BOK-01       -
A0A2K5JHM2_BAX-03       P
A0A2K5JHM2_BAX-05       -
A0A2K5JHM2_BAX-04       -
A0A2K5JHM2_BAX-01       -
                         

© 1998-2019