Dataset for protein Bax of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5JHM2_BAX-02      MDGSGEQPRGGGPTSSEQIMKTGALL------------------------
A0A2K5JHM2_BAX-03      MDGSGEQPRGGVSSRIEQ-----------------------GEWLALDPV
A0A2K5JHM2_BAX-05      MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPV
A0A2K5JHM2_BAX-04      MDGSGEQPRGGGVTPRSDSAPS--------LHPHSRRMGGETPELALDPV
A0A2K5JHM2_BAX-01      MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPV
                       ***********  :  .:                                

A0A2K5JHM2_BAX-02      -------------------------LQGMIAAVDTDSPREVFFRVAADMF
A0A2K5JHM2_BAX-03      PQDASTKRLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
A0A2K5JHM2_BAX-05      PQDASTKRLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
A0A2K5JHM2_BAX-04      PQDASTKRLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
A0A2K5JHM2_BAX-01      PQDASTKRLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
                                                ** **********************

A0A2K5JHM2_BAX-02      SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG
A0A2K5JHM2_BAX-03      SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG
A0A2K5JHM2_BAX-05      SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG
A0A2K5JHM2_BAX-04      SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG
A0A2K5JHM2_BAX-01      SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG
                       **************************************************

A0A2K5JHM2_BAX-02      WIQDQGGWDGLL-----SYFGTPTWQTVTIL----------VAGVLTASL
A0A2K5JHM2_BAX-03      WIQDQGGWGLPLAESLKRLLSLSPGRPPLLLWDAHVADRDHLGGWSTHCL
A0A2K5JHM2_BAX-05      WIQDQGGWVRLLNPPHPNHRPCPTVPWCPLP----------IFGSSDVVY
A0A2K5JHM2_BAX-04      WIQDQGGWDGLL-----SYFGTPTWQTVTIL----------VAGVLTASL
A0A2K5JHM2_BAX-01      WIQDQGGWDGLL-----SYFGTPTWQTVTIL----------VAGVLTASL
                       ********   *          ..     :           : *      

A0A2K5JHM2_BAX-02      TIWKKMG--------------
A0A2K5JHM2_BAX-03      AHHLEEDGLRPPAALNCVFPP
A0A2K5JHM2_BAX-05      NAFPYVS--------------
A0A2K5JHM2_BAX-04      TIWKKMG--------------
A0A2K5JHM2_BAX-01      TIWKKMG--------------
                             .              

© 1998-2019