Dataset for protein Bak1 of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5IYH0_BAK1-02      MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAE
A0A2K5IYH0_BAK1-01      MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAE
                        **************************************************

A0A2K5IYH0_BAK1-02      GAAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL
A0A2K5IYH0_BAK1-01      GAAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL
                        **************************************************

A0A2K5IYH0_BAK1-02      QPTAENAYEYFTKIASRPAATPTACLRVASTGAVW---------------
A0A2K5IYH0_BAK1-01      QPTAENAYEYFTKIAS----------SLFESGINWGRVVALLGFGYRLAL
                        ****************           : .:*  *               

A0A2K5IYH0_BAK1-02      --------------------WLFWASATVW----------------PYTS
A0A2K5IYH0_BAK1-01      HVYQRGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILN
                                            :::. . : *                *  .

A0A2K5IYH0_BAK1-02      TSAA-----------------
A0A2K5IYH0_BAK1-01      VLVVLGVVLLGQFVVRRFFKS
                        . ..                 

© 1998-2019