Dataset for protein BAX-like of organism Chlorocebus sabaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0D9S330_BAX-01       MDGSGEQPRGGGP------------TSSEQIMKTGALLLQGFIQDRAGRM
A0A0D9R0C9_BOK-01       ----MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRA
A0A0D9RB69_BAK1-01      ----MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQE
                                .  .             .:.:::      : . ::  *  . 

A0A0D9S330_BAX-01       G-------GETPELALDPVPQDASTKRLSECLKRIGDELDSNMELQRMIA
A0A0D9R0C9_BOK-01       GLSWSAPERAAPVPGRLA-EVCAVLLRLGDELEMIRPSVYRNVARQLHIS
A0A0D9RB69_BAK1-01      QEAEGAAAPADPEMDTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTM
                                   *     .    :   .:.  *  *  .:  .   :    

A0A0D9S330_BAX-01       AVD----TDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCT
A0A0D9R0C9_BOK-01       LQS-EPVVTDA---FLAVAGHIFSAG-ITWGKVVSLYAVAAGLAVDCVRQ
A0A0D9RB69_BAK1-01      LQHLQPTAENAYEYFTKIASSLFESG-INWGRVVALLGFGYRLALHVYQH
                               . ..   *  :*. :*. * :.**.**:*  ..  *.:     

A0A0D9S330_BAX-01       KVPELIRTIMGWTLDF-LRERLLGWIQDQGGWDGLLSYF--GTPTWQTVT
A0A0D9R0C9_BOK-01       AQPAMVHALVDCLGEF-VRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHW
A0A0D9RB69_BAK1-01      GLTGFLGHVTRFVVDFMLHHCIARWIAQRGGWVAALNL---GNGPILNVL
                          . ::  :     :* :.  :  *:  .***   *.          .  

A0A0D9S330_BAX-01       ILVAGVLTASLTIWKKMG-----
A0A0D9R0C9_BOK-01       LVAALCSFGRFLKAAFFVLLPER
A0A0D9RB69_BAK1-01      VVLGVVLLGQFVVRRFFKS----
                        :: .    . :     :      

© 1998-2019