Dataset for protein BAX-like of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5N1M7_BAK1-02      MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAE
A0A2K5KU58_BAX-04       ---MDGSGEQPRGGGP-----TSSEQIMKTGALLLQGFIQDR-------A
A0A2K5KU58_BAX-01       ---MDGSGEQPRGGGP-----TSSEQIMKTGALLLQGFIQDR-------A
A0A2K5KU58_BAX-02       ---MDGSGEQPRGGGP-----TS---------------------------
A0A2K5KU58_BAX-03       ---MDGSGEQPRGGGE-----AG-------GRRAGGGFIQDR-------A
A0A2K5L9Q9_BOK-01       MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSW
A0A2K5N1M7_BAK1-01      MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAE
A0A2K5KTQ1_BAK1-03      MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFD-----RHQQEQEAE
A0A2K5KTQ1_BAK1-01      MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFD-----RHQQEQEAE
A0A2K5KTQ1_BAK1-02      MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFD-----RHQQEQEAE
                              ..             .                            

A0A2K5N1M7_BAK1-02      GAAAPADPEMDTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQQL
A0A2K5KU58_BAX-04       GRMGGETPELALDPVPQDASTKRLSECLKRIGDELDSN------MELQRM
A0A2K5KU58_BAX-01       GRMGGETPELALDPVPQDASTKRLSECLKRIGDELDSN------MELQRM
A0A2K5KU58_BAX-02       ------------------------SEQIMKTGALL-----------LQGM
A0A2K5KU58_BAX-03       GRMGGETPELALDPVPQDASTKRLSECLKRIGDELDSN------MELQRM
A0A2K5L9Q9_BOK-01       SAPERAAP--------VPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQL
A0A2K5N1M7_BAK1-01      GAAAPADPEMDTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQQL
A0A2K5KTQ1_BAK1-03      G-----------------STVGQVGRQI----------------TMLQHL
A0A2K5KTQ1_BAK1-01      GPAAPADPEMVTLPLQPSSTVGQVGRQI----------------TMLQHL
A0A2K5KTQ1_BAK1-02      GPAAPADPEMVTLPLQPSSTVGQVGRQI----------------TMLQHL
                                                   :                   . :

A0A2K5N1M7_BAK1-02      QPTAEN---AYEYFTKIASRPAATP---------------TACLRVASTG
A0A2K5KU58_BAX-04       IAAVDTDS-PREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTK
A0A2K5KU58_BAX-01       IAAVDTDS-PREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTK
A0A2K5KU58_BAX-02       IAAVDTDS-PREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTK
A0A2K5KU58_BAX-03       IAAVDTDS-PREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTK
A0A2K5L9Q9_BOK-01       HISLQSEPVVTDAFLAVAGHIFSAG-ITWGKVVSLYAVAAGLAVDCVRQA
A0A2K5N1M7_BAK1-01      QPTAEN---AYEYFTKIASSLFESG-INWGRVVALLGFGYRLALHVYQHG
A0A2K5KTQ1_BAK1-03      QRTAEN---AYEYFTKIASSLFESG-INQGRVVALLGFSYHLVLHVYQRG
A0A2K5KTQ1_BAK1-01      QRTAEN---AYEYFTKIASSLFESG-INQGRVVALLGFSYHLVLHVYQRG
A0A2K5KTQ1_BAK1-02      QRTAEN---AYEYFTKIASSLFESG-INQGRVVALLGFSYHLVLHVYQRG
                          : :.     : *  :*.                        :      

A0A2K5N1M7_BAK1-02      A--------------------VWWLF----WASATVWPYTSTSTA-----
A0A2K5KU58_BAX-04       VPELIRTIMGWTL-DFLRERLLGWIQDQGGWVRLLNPPHPNHRPCPTVPA
A0A2K5KU58_BAX-01       VPELIRTIMGWTL-DFLRERLLGWIQDQGGWDGLL-----------SYFG
A0A2K5KU58_BAX-02       VPELIRTIMGWTL-DFLRERLLGWIQDQGGWDGLL-----------SYFG
A0A2K5KU58_BAX-03       VPELIRTIMGWTL-DFLRERLLGWIQDQGGWDGLL-----------SYFG
A0A2K5L9Q9_BOK-01       QPAMVHALVDCLG-EFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSH--
A0A2K5N1M7_BAK1-01      LTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNL---GNGPILNV--
A0A2K5KTQ1_BAK1-03      LTGFLGQVTRFVV-FMLQHCIAWWIAQRGSWVAALDL---GNGPILNM--
A0A2K5KTQ1_BAK1-01      LTGFLGQVTRFVV-FMLQHCIAWWIAQRGSWVS-----------LPSL--
A0A2K5KTQ1_BAK1-02      LTGFLGQVTRFVV-FMLQHCIAWWIAQRGSWVAALDL---GNGPILNM--
                                               *:     *                   

A0A2K5N1M7_BAK1-02      --------------------------------
A0A2K5KU58_BAX-04       HPLSQWCPLPIFGSSDVVYNAFPYVS------
A0A2K5KU58_BAX-01       TPTWQTVTILVAGVLTASLTIWKKMG------
A0A2K5KU58_BAX-02       TPTWQTVTILVAGVLTASLTIWKKMG------
A0A2K5KU58_BAX-03       TPTWQTVTILVAGVLTASLTIWKKMG------
A0A2K5L9Q9_BOK-01       --------WLVAALCSFGRFLKAAFFVLLPER
A0A2K5N1M7_BAK1-01      --------LVVLGVVLLGQFVVRRFFKS----
A0A2K5KTQ1_BAK1-03      --------LVILGVVLLGPFVVQRFFKS----
A0A2K5KTQ1_BAK1-01      --------LPCRGC----PSKAQKL-------
A0A2K5KTQ1_BAK1-02      --------LVILGVVLLGPFVVQRFFKS----
                                                        

© 1998-2019