Dataset for protein Bak1 of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5N1M7_BAK1-02      MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAE
A0A2K5N1M7_BAK1-01      MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAE
A0A2K5KTQ1_BAK1-03      MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFD-----RHQQEQEAE
A0A2K5KTQ1_BAK1-01      MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFD-----RHQQEQEAE
A0A2K5KTQ1_BAK1-02      MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFD-----RHQQEQEAE
                        ******** ******* **********:** *:**      *********

A0A2K5N1M7_BAK1-02      GAAAPADPEMDTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQQL
A0A2K5N1M7_BAK1-01      GAAAPADPEMDTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQQL
A0A2K5KTQ1_BAK1-03      G-----------------STVGQVGRQI----------------TMLQHL
A0A2K5KTQ1_BAK1-01      GPAAPADPEMVTLPLQPSSTVGQVGRQI----------------TMLQHL
A0A2K5KTQ1_BAK1-02      GPAAPADPEMVTLPLQPSSTVGQVGRQI----------------TMLQHL
                        *                 **:******:                ****:*

A0A2K5N1M7_BAK1-02      QPTAENAYEYFTKIASRPAATPTACLRVAS--------------------
A0A2K5N1M7_BAK1-01      QPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQHGLTGF
A0A2K5KTQ1_BAK1-03      QRTAENAYEYFTKIASSLFESGINQGRVVALLGFSYHLVLHVYQRGLTGF
A0A2K5KTQ1_BAK1-01      QRTAENAYEYFTKIASSLFESGINQGRVVALLGFSYHLVLHVYQRGLTGF
A0A2K5KTQ1_BAK1-02      QRTAENAYEYFTKIASSLFESGINQGRVVALLGFSYHLVLHVYQRGLTGF
                        * **************    :     **.:                    

A0A2K5N1M7_BAK1-02      --------------TGAVWWLF----WASATVWPYTSTSTA---------
A0A2K5N1M7_BAK1-01      LGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLL
A0A2K5KTQ1_BAK1-03      LGQVTRFVV-FMLQHCIAWWIAQRGSWVAALDLGNGPILNMLVILGVVLL
A0A2K5KTQ1_BAK1-01      LGQVTRFVV-FMLQHCIAWWIAQRGSWVS--------LPSLLPCRGC---
A0A2K5KTQ1_BAK1-02      LGQVTRFVV-FMLQHCIAWWIAQRGSWVAALDLGNGPILNMLVILGVVLL
                                         ..*:     *.:          .          

A0A2K5N1M7_BAK1-02      -----------
A0A2K5N1M7_BAK1-01      GQFVVRRFFKS
A0A2K5KTQ1_BAK1-03      GPFVVQRFFKS
A0A2K5KTQ1_BAK1-01      -PSKAQKL---
A0A2K5KTQ1_BAK1-02      GPFVVQRFFKS
                                   

© 1998-2019