Dataset for protein BAX-like of organism Cavia porcellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A286XGM4_BOK-01      VRIRLVAMGLGEVKWRSAWRSWGPSQPGMGAVS-----------------
H0UT71_BAK1-01         ---------------MASDQGPGPLREGCGGASPLSEEEQQVVRDTEEVF
                                       :: .. ** . * *..*                 

A0A286XGM4_BOK-01      ------------------------HSHVCPP--------------GDELE
H0UT71_BAK1-01         QSYVYHRHQQDRGGTQGRVPRAHPTAHCCFLSSTLTQVGCQLAIIGDDIN
                                                :* *                **:::

A0A286XGM4_BOK-01      QIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYS
H0UT71_BAK1-01         RRYGSDIEAMLQQLQPTADNAP---DLFYKIACSLFKPGPTWGRVVALLA
                       .   *    : .**: : :. *   * *  :*  :*..* ***.**:* :

A0A286XGM4_BOK-01      VAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLAT--------WLRRRGG
H0UT71_BAK1-01         FGYRLALHVYQQ------HGLSGFLGKVTRLVVDSMLQLNVVRWIVEKGG
                       ..  **:   .*      *.* . **:..* .: :        *:  .**

A0A286XGM4_BOK-01      WTDVLKCVVSTDPSLHSHWLVA---ALCNFGRFLKAAFFVLLPER
H0UT71_BAK1-01         WVAALDWAGTFRPI----WTVVTAFAIVMVGQYVIRRFFKSS---
                       *. .*. . :  *     * *.   *:  .*.::   **      

© 1998-2019