Dataset for protein BAX-like of organism Castor canadensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A250YBQ3_BAX-01       -MDGSGEQPRGGG-------PTSSEQIMKTGALLLQGFI-------QDRA
A0A250YBQ3_BAX-02       MKTG---------------------------ALLLQGFI-------QDRA
A0A250YC64_BAK1-02      MASGQGPGPPKEGLEEPSSDSTSEQQVVQDTEEVFRSYVFYRHQQEQEAQ
A0A250YC64_BAK1-01      MASGQGPGPPKEGLEEPSSDSTSEQQVVQDTEEVFRSYVFYRHQQEQEAQ
A0A250YC64_BAK1-03      MASGQGPGPPKEGLEEPSSDSTSEQQVVQDTEEVFRSYVFYRHQQEQEAQ
                           *                             ::..::       *:  

A0A250YBQ3_BAX-01       GRMGGETPELTLEQMHQDASTKKLSECLKRIGDELDS--NMELQRMIADV
A0A250YBQ3_BAX-02       GRMGGETPELTLEQMHQDASTKKLSECLKRIGDELDS--NMELQRMIADV
A0A250YC64_BAK1-02      GAAAPADPELVSLPQEPNSTMGQVGRRLAIIGDDINRRYDTEFQTMLQQL
A0A250YC64_BAK1-01      GAAAPADPELVSLPQEPNSTMGQVGRRLAIIGDDINRRYDTEFQTMLQQL
A0A250YC64_BAK1-03      GAAAPADPELVSLPQEPNSTMGQVGRRLAIIGDDINRRYDTEFQTMLQQL
                        *  .   ***.      :::  ::.  *  ***:::   : *:* *: ::

A0A250YBQ3_BAX-01       --DTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPE
A0A250YBQ3_BAX-02       --DTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPE
A0A250YC64_BAK1-02      RPTAENASELFTKIASSLFDSG-ISWGRVVALLSFGYRLAVHVYQRGLTG
A0A250YC64_BAK1-01      RPTAENASELFTKIASR---------------------------------
A0A250YC64_BAK1-03      RPTAENASELFTKIASR---------------------------------
                           ::.. *:* .:*:                                  

A0A250YBQ3_BAX-01       LIRTIMGWTLEFL-RERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
A0A250YBQ3_BAX-02       LIRTIMGWTLEFL-RERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
A0A250YC64_BAK1-02      FLGQVTYFVIDVMLRHYITRWIAQRGGWVAALELGNGPIRNVVIVLAVVL
A0A250YC64_BAK1-01      ---CTAWPLCPLSRHHPCMQWAPWSGH--TSLAVSGGSVLTHMWSLSPLL
A0A250YC64_BAK1-03      ---PAATPTVCLT-------------------VASAGAV----WWLS---
                                   .                         .       :    

A0A250YBQ3_BAX-01       LTASLTIWKKMG
A0A250YBQ3_BAX-02       LTASLTIWKKMG
A0A250YC64_BAK1-02      LGQFVVRRFFKS
A0A250YC64_BAK1-01      CINS--------
A0A250YC64_BAK1-03      ------------
                                    

© 1998-2019