Dataset for protein BAX-like of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A076FVB8_BAX-01       --------MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGET
A0A452EUN4_BAK1-01      MASGQGPGPPRQGCDEPDPSSASEEQVARDTEEVFRSYVFYRHQQEQEAE
A0A452G7C4_BOK-01       MEVLRRSSVLAAEIMDAFDRSPTDKELVAQAKALGREFVHARLLRAGLSW
                                            ..:.:::      : . ::  *  .     

A0A076FVB8_BAX-01       PELGLEQVPQDASTKKLSECLKRIGDEL-----------DSNMELQRMIA
A0A452EUN4_BAK1-01      GAAAPTDPEMVTLHPEPTSTMGQVGRQLAVIGDDINRRYDTEFQAMLQHL
A0A452G7C4_BOK-01       SAPERAAPVPGGRLAEVCAVLLRLADELELIRPSVYRNVARQLNLSLQSE
                                       :    : .:. :*             :::      

A0A076FVB8_BAX-01       AVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPE
A0A452EUN4_BAK1-01      QPTADNAYEYFTKIASSLFESG-INWGRVVALLGFGYRLALHVYQRGLTG
A0A452G7C4_BOK-01       TVVTDA----FLAVATQIFSAG-ITWGKVVSLYSVAAGLAVDCVRQAQPA
                           :*     *  :*:.:*. * :.**.**:*  ..  *.:       . 

A0A076FVB8_BAX-01       LIRTIMGWTLDF-LRERLLGWIQDQGGWDGLLSYF--GTPTWQTVTIFVA
A0A452EUN4_BAK1-01      FLGQVTRFVADFMLRRSIARWIAQRGGWVAALDL---GNAPIKNVAIVLA
A0A452G7C4_BOK-01       LVHALVDCLGEF-VRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAA
                        ::  :     :* :*  :  *:  .***   *.      .  ..  :. *

A0A076FVB8_BAX-01       GVLTASLTIWKKMG-----
A0A452EUN4_BAK1-01      VVLLGQFVVRRFFKS----
A0A452G7C4_BOK-01       LCSFGRFLKAAFFMLLPER
                            . :     :      

© 1998-2019