Dataset for protein BAX-like of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6PMP8_BAK1-01      ----------MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAE
Q52HB2_BAK1-01      ----------MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAE
F1PAN9_BAX-01       MSHPSSLGPLGPKSPGTSSLLSPLG-----PTSSEQIMKTGALLLQGFI-------QDRA
F1PAN9_BAX-02       -------------MDGSGEQPRGGG-----PTSSEQIMKTGALLLQGFI-------QDRA
Q8HYU5_BAX-01       -------------MDGSGEQPRGGG-----PTSSEQIMKTGALLLQGFI-------QDRA
                                   *..      *     .**.**: .    ::..::       *:  

F6PMP8_BAK1-01      GAAVPADPEMVTLPLEPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEY
Q52HB2_BAK1-01      GAAVPADPEMVTLPLEPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEY
F1PAN9_BAX-01       GRMGGETPELPLEQVPQDASTKKLSECLKRIGDELDS--NMELQRMIAAVD--TDSPREV
F1PAN9_BAX-02       GRMGGETPELPLEQVPQDASTKKLSECLKRIGDELDS--NMELQRMIAAVD--TDSPREV
Q8HYU5_BAX-01       GRMGGETPELPLEQVPQDASTKKLSECLKRIGDELDS--NMELQRMIAAVD--TDSPREV
                    *      **:    :  .::  ::.  *  ***:::.  : *:* *:  ::  ::.. * 

F6PMP8_BAK1-01      FTKIASSLFESG-INWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIAR
Q52HB2_BAK1-01      FTKIASSLFESG-INWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIAR
F1PAN9_BAX-01       FFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDF-LRERLLG
F1PAN9_BAX-02       FFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDF-LRERLLG
Q8HYU5_BAX-01       FFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDF-LRERLLG
                    * .:*:.:*..* :********: *. .*.*:.    :. ::  :  :. ** *.  :  

F6PMP8_BAK1-01      WIAQRGGWVAALNLGNGPILNVLIVLSVVLLGQFVPTGLGERREKFMIKPNAGSGCRWSP
Q52HB2_BAK1-01      WIAQRGGWVAALNLGNGPILNVLIVLSVVLLGQFVVRRFFKS------------------
F1PAN9_BAX-01       WIQDQGGWVRPVTPSPQLL-----------------------------------------
F1PAN9_BAX-02       WIQDQGGWVRPVTP----------------------------------------------
Q8HYU5_BAX-01       WIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG------------------
                    ** :.***   :.                                               

F6PMP8_BAK1-01      LTSPHPLSVSENKL
Q52HB2_BAK1-01      --------------
F1PAN9_BAX-01       --------------
F1PAN9_BAX-02       --------------
Q8HYU5_BAX-01       --------------
                                  

© 1998-2019