Dataset for protein Bax of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F1PAN9_BAX-01      MSHPSSLGPLGPKSPGTSSLLSPLGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELPL
F1PAN9_BAX-02      -------------MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELPL
Q8HYU5_BAX-01      -------------MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELPL
                                  *:..     ************************************

F1PAN9_BAX-01      EQVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNW
F1PAN9_BAX-02      EQVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNW
Q8HYU5_BAX-01      EQVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNW
                   ************************************************************

F1PAN9_BAX-01      GRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRPVTPSPQ
F1PAN9_BAX-02      GRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRPVTP---
Q8HYU5_BAX-01      GRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGT
                   ***************************************************   ::    

F1PAN9_BAX-01      LL-----------------------
F1PAN9_BAX-02      -------------------------
Q8HYU5_BAX-01      PTWQTVTIFVAGVLTASLTIWKKMG
                                            

© 1998-2019