Dataset for protein Bak1 of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6PMP8_BAK1-01      MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEM
Q52HB2_BAK1-01      MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEM
                    ************************************************************

F6PMP8_BAK1-01      VTLPLEPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
Q52HB2_BAK1-01      VTLPLEPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
                    ************************************************************

F6PMP8_BAK1-01      SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
Q52HB2_BAK1-01      SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
                    ************************************************************

F6PMP8_BAK1-01      LNLGNGPILNVLIVLSVVLLGQFVPTGLGERREKFMIKPNAGSGCRWSPLTSPHPLSVSE
Q52HB2_BAK1-01      LNLGNGPILNVLIVLSVVLLGQFVVRRFFKS-----------------------------
                    ************************   : :                              

F6PMP8_BAK1-01      NKL
Q52HB2_BAK1-01      ---
                       

© 1998-2019