Dataset for protein Bok of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6SBR3_BOK-01      MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPFP
F6SBR3_BOK-02      MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPFP
                   ************************************************************

F6SBR3_BOK-01      GRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITW
F6SBR3_BOK-02      GRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGMPS
                   *********************************************************:. 

F6SBR3_BOK-01      GKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVN
F6SBR3_BOK-02      LPIPWDLREGSGVCGSVLQGPHEPAPAHPGAAQCSLVLSRCCRCLELPSDQCGSSGLKLQ
                     :      .:*:. . :. .: .       .  .:* .  .  *   ... .     ::

F6SBR3_BOK-01      TDPGLRSHWLLAALCSFGRFLKAAFFVLLPER
F6SBR3_BOK-02      HSGSLVVLWVGG---HAGQLAQAS--------
                    . .*   *: .     *.: :*:        

© 1998-2019