Dataset for protein BAX-like of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U3BU97_BAX-03       MDGSGEQPRGEGP------------TSSEQIMKTGALLLQG-------------------
U3BU97_BAX-02       MDGSGEQPRGEGE------------AGG----------------SRAG--EGRTPELALD
U3BU97_BAX-01       MDGSGEQPRGEGP------------TSSEQIMKTGALLLQGFIQDRAGRIAGETPELALD
U3BU97_BAX-04       MDGSGEQPRGEGP------------TSSEQIMKTGALLLQGFIQDRAGRIAGETPELALD
F6SBR3_BOK-01       ----MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLR-AGLSWSAPER
F7ICC2_BAK1-01      ----MASGQGPGPPRQECGEPDPPSASEEQVARDTEEVFHSYVFYRHRQ-EQEAEGAAAP
                            .  .             .                                  

U3BU97_BAX-03       ----------------------------------------MIAAVD--TDSPREVFFRVA
U3BU97_BAX-02       PVPQDASTK-KLSECLKRIGDELD---------SNMELQRMIAAVD--TDSPREVFFRVA
U3BU97_BAX-01       PVPQDASTK-KLSECLKRIGDELD---------SNMELQRMIAAVD--TDSPREVFFRVA
U3BU97_BAX-04       PVPQDASTK-KLSECLKRIGDELD---------SNMELQRMIAAVD--TDSPREVFFRVA
F6SBR3_BOK-01       AAPFPGRLA-EVCAVLLRLGDELEMIRPSVYRNVARQLHISLQS-EPVVTDA---FLAVA
F7ICC2_BAK1-01      ADPEMVSLSLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIA
                                                             :   :  . ..   *  :*

U3BU97_BAX-03       ADMFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDF-LRERLLGWIQDQ
U3BU97_BAX-02       ADMFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDF-LRERLLGWIQDQ
U3BU97_BAX-01       ADMFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDF-LRERLLGWIQDQ
U3BU97_BAX-04       ADMFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDF-LRERLLGWIQDQ
F6SBR3_BOK-01       GHIFSAG-ITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEF-VRKTLATWLRRR
F7ICC2_BAK1-01      SSLFESG-INWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVVDFMLHHCIARWIAQR
                    . :*. * :.**.**:*  ..  *.:       . ::  :     :* :.  :  *:  .

U3BU97_BAX-03       GGWDGLLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG------
U3BU97_BAX-02       GGWDGLLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG------
U3BU97_BAX-01       GGWDGLLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG------
U3BU97_BAX-04       GGWVRPLYPSCPASPDSSGTLGLPSRSQSSDVVYNAF-------
F6SBR3_BOK-01       GGWTDVLKCVVNTDPGLRSHWLLAALCSFGRFLKAAFFVLLPER
F7ICC2_BAK1-01      GGWVAALDL---GNGPILNVLVVLGVVLLGQFVVRRFFKS----
                    ***   *               : .    .  :   :       

© 1998-2019