Dataset for protein Bax of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U3BU97_BAX-03      MDGSGEQPRGEGPTSSEQIMKTGALLLQG-------------------------------
U3BU97_BAX-02      MDGSGEQPRGEGEAGG----------------SRAG--EGRTPELALDPVPQDASTKKLS
U3BU97_BAX-01      MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIAGETPELALDPVPQDASTKKLS
U3BU97_BAX-04      MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIAGETPELALDPVPQDASTKKLS
                   ************ :..                                            

U3BU97_BAX-03      ------------------MIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
U3BU97_BAX-02      ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
U3BU97_BAX-01      ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
U3BU97_BAX-04      ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
                                     ******************************************

U3BU97_BAX-03      VLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFFGTPTWQTVTIFVAG
U3BU97_BAX-02      VLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFFGTPTWQTVTIFVAG
U3BU97_BAX-01      VLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFFGTPTWQTVTIFVAG
U3BU97_BAX-04      VLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRPLYPSCPASPDSSGTLGLPS
                   **************************************   *     :.. .: *: :..

U3BU97_BAX-03      VLTASLTIWKNMG
U3BU97_BAX-02      VLTASLTIWKNMG
U3BU97_BAX-01      VLTASLTIWKNMG
U3BU97_BAX-04      RSQSSDVVYNAF-
                      :* .::: : 

© 1998-2019