Dataset for protein Bak1 of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7ICC2_BAK1-02      MGLCHSWELGRPGGSCPSLMAAPLSCWAPTPIQDLVSFLFSPCLPLVPEPSIHVLEHCRG
F7ICC2_BAK1-03      --MASGQGPGPPRQECGE-----------------------------PDPPSASEEQVAR
F7ICC2_BAK1-04      --MASGQGPGPPRQECGE-----------------------------PDPPSASEEQVAR
F7ICC2_BAK1-01      --MASGQGPGPPRQECGE-----------------------------PDPPSASEEQVAR
                      :. ..  * *  .* .                             *:*.    *:   

F7ICC2_BAK1-02      SPRRGAQGHGQLGQKPSAMMQALAPTAWPPAHLPASRSHSTMGQVGRQLAIIGDDINRRY
F7ICC2_BAK1-03      DTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAIIGDDINRRY
F7ICC2_BAK1-04      DTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAIIGDDINRRY
F7ICC2_BAK1-01      DTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAIIGDDINRRY
                    ..    :.:    :. .   :. *..* *     : .. *********************

F7ICC2_BAK1-02      DSEFQTMLQHLQPTAENAYEYFTKIASSL---FESGINWGRVVALLGFGYRLALHVYQRG
F7ICC2_BAK1-03      DSEFQTMLQHLQPTAENAYEYFTKIASRP-------------------------------
F7ICC2_BAK1-04      DSEFQTMLQHLQPTAENAYEYFTKIASRYPDHLPAGL-WSLSCPVTTSPWP---------
F7ICC2_BAK1-01      DSEFQTMLQHLQPTAENAYEYFTKIASSL---FESGINWGRVVALLGFGYRLALHVYQRG
                    ***************************                                 

F7ICC2_BAK1-02      LTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALDLGNGPILNVLVVLGVVLLGQFVVR
F7ICC2_BAK1-03      --------------------------ATPTACLRVASTGAVWWLSWALATVWPYTSTSAA
F7ICC2_BAK1-04      -------------AYMMHSWPGRHLLSVSSVCCELTCGLGLLFFSLRVPDSFVFCALAHS
F7ICC2_BAK1-01      LTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALDLGNGPILNVLVVLGVVLLGQFVVR
                                                      :    .       :            

F7ICC2_BAK1-02      RFFKS
F7ICC2_BAK1-03      -----
F7ICC2_BAK1-04      SFQH-
F7ICC2_BAK1-01      RFFKS
                         

© 1998-2019