Dataset for protein BAX-like of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A6H6W7_BOK-01       MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREFVHARLLRAGLSWSAPERAAPVP
Q05KI7_BAK1-01      MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPTDPEM
O02703_BAX-01       --------MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQ
O02703_BAX-03       ---------------------------MKTGALLLQGFIQDRAGRMGGETPELGLEQVPQ
O02703_BAX-02       --------MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQ
                                                     : . ::  *  .               

A6H6W7_BOK-01       GGRLAEVCAVLLRLADELELIRPSVYRNVARQLNLSLQSETVVTDA----FLAVATQIFS
Q05KI7_BAK1-01      VTLHPEPSSTMGQVGRQLAVIGDDINRRYDAEFQAMLQHLQPTADNAYEYFTKIASSLFE
O02703_BAX-01       DASTKKLSECLKRIGDEL-----------DSNMELQRMIAAVDTDSPREVFFRVAAEMFS
O02703_BAX-03       DASTKKLSECLKRIGDEL-----------DSNMELQRMIAAVDTDSPREVFFRVAAEMFS
O02703_BAX-02       DASTKKLSECLKRIGDEL-----------DSNMELQRMIAAVDTDSPREVFFRVAAEMFS
                         : .  : .:. :*             :::         :*     *  :*:.:*.

A6H6W7_BOK-01       AG-ITWGKVVSLYSVAAGLAVDCVRQAQPALVHALVDCLGEF-VRKTLATWLRRRGGWTD
Q05KI7_BAK1-01      SG-INWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRSIARWIAQRGGWVA
O02703_BAX-01       DGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWDG
O02703_BAX-03       DGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWVR
O02703_BAX-02       DGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWVR
                     * :.**.**:*  ..  *.:       . ::  :     :* :*  :  *:  .***  

A6H6W7_BOK-01       VLK-----------------------------------------------------CVVS
Q05KI7_BAK1-01      ALD-----------------------------------------------------L---
O02703_BAX-01       LLS------------------------YFG------------------------------
O02703_BAX-03       PLTPPHSPTPLGPLGLSVPTIGVPPSPFWGHMSDQPLIHRVPNDLSMTLDLLVTSDLLVT
O02703_BAX-02       PLTPPHSPTPLGPLGLSVPTIGVPPSPFWGHMSDQPLIHRVPNDLSMTLDLLVTSDLLVT
                     *                                                          

A6H6W7_BOK-01       TDPGLRSHWLVAALCSFGRF----------------------------------------
Q05KI7_BAK1-01      GNGPIKSVAIVLAVVLLGQF----------------------------------------
O02703_BAX-01       ------TPTWQTVTIFVAGV----------------------LTASLTIWKK--------
O02703_BAX-03       PDPMPRCPPWCLPPIPLESLKFYDNPLTSPLVGPCPYLCPLTPPCSLMCWPRGCPLAESL
O02703_BAX-02       PDPMPRCPPWCLPPIPLESLKFYDNPLTSPLVGPCPYLCPLTPPCSLMCWPRGCPLAESL
                                    .  .                                        

A6H6W7_BOK-01       ------------------------------------------------------------
Q05KI7_BAK1-01      ------------------------------------------------------------
O02703_BAX-01       ------------------------------------------------------------
O02703_BAX-03       KCLLSLSPGRPPLLLWDTHMADSDHLCGWSAHRLAHHLEEDGLRPSTALDFFCINYGIFQ
O02703_BAX-02       KCLLSLSPGRPPLLLWDTHMADSDHLCGWSAHRLAHHLEEDGLRPSTALDFFCINYGIFQ
                                                                                

A6H6W7_BOK-01       -------LKAAFFMLLPER
Q05KI7_BAK1-01      -------VVRRFFKS----
O02703_BAX-01       -----MG------------
O02703_BAX-03       GGGADLGAMEFFLLF----
O02703_BAX-02       GGGADLGAMEFFLLF----
                                       

© 1998-2019