Dataset for protein Bax of organism Bos mutus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


L8IM55_BAX-02      MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLS
L8IM55_BAX-01      -------MRPHSDSVSPQLRSH-----PSFIQDRAGRMGGETPELGLEQVPQDASTKKLS
                           *  . : * *: .       .*******************************

L8IM55_BAX-02      ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
L8IM55_BAX-01      ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
                   ************************************************************

L8IM55_BAX-02      VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLS-----------------
L8IM55_BAX-01      VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRPLTPPHSPTPLGPLGLSVPT
                   **************************************   *:                 

L8IM55_BAX-02      ------------------------------------------------------------
L8IM55_BAX-01      IGVPPSPFWGHMSDQPLIHRVPNDLSMTLDLLMTSDLLVTPDPMPRCPPWCLPPIPLESL
                                                                               

L8IM55_BAX-02      -YFGTP------------------------------------------------------
L8IM55_BAX-01      KFYDNPLTSPLVGPCPYLCPLTPPCSLMCWPRGCPLAESMKCLLSLSPGRPPLLLWDTHM
                    ::..*                                                      

L8IM55_BAX-02      ------------------------------------------------------------
L8IM55_BAX-01      ADSDHLCGWSAHRLAHHLEEDGLRPSTALDFFCINYGIFQGGGADLGAMGVFLTFLIIGV
                                                                               

L8IM55_BAX-02      -------TWQTVTIFVAGVLTASLTIWKKMG-----------------------------
L8IM55_BAX-01      GQGREAWSWGVGTINLFRTTLWSLSHWARFLAVAGDQASCADPSFSEGNQCPLWVSGELN
                          :* . ** :  .   **: * .:                              

L8IM55_BAX-02      -----------------
L8IM55_BAX-01      CGSALKEPTVLRGTEAA
                                    

© 1998-2019