Dataset for protein Bak1 of organism Bos mutus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


L8IT09_BAK1-01      MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYEQEAEGAAAPTDPEMVTLHPEP
L8IT09_BAK1-02      MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRPNSLAAS---------RS
                    **************************************     .: *.:          .

L8IT09_BAK1-01      SSTMGQVGRQLAVIGDDINRRYDAEFQAMLQHLQPTADNAYEYFTKIASSLFESGINWGR
L8IT09_BAK1-02      SSTMGQVGRQLAVIGDDINRRYDAEFQAMLQHLQPTADNAYEYFTKIASSLFESGINWGR
                    ************************************************************

L8IT09_BAK1-01      VVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRSIARWIAQRGGWVAALDLGNGP
L8IT09_BAK1-02      VVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRSIARWIAQRGGWVAALDLGNGP
                    ************************************************************

L8IT09_BAK1-01      IKSVAIVLAVVLLGQFVVRRFFKS
L8IT09_BAK1-02      IKSVAIVLAVVLLGQFVVRRFFKS
                    ************************

© 1998-2019