Dataset for protein Bok of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B1IPM7_BOK-01      MKGMEVLRRSSVFAAEVMEVFERSPTDKELVSQSKVLCRDYIHSRLNRAG
W5KF74_BOK-01          -----------------MDLMDRGPSEKELVFQSKILCRDFIYSRITREG
                                        *::::*.*::**** ***:****:*:**:.* *

A0A3B1IPM7_BOK-01      IGWSKADHGLSA---GGSLGEVSSVLLWLGDELEYLRPNVYRNVARQLNI
W5KF74_BOK-01          LNWSKVESSLPVPVPDGALGDVSMVLLKLGDELEYMRPYIYRNVAKQLSI
                       :.***.: .*..   .*:**:** ***.*******:** :*****.**.*

A0A3B1IPM7_BOK-01      TVASESVVSDAFLAVAAEIFSTGVTWGKVVSLYAVAGALA----------
W5KF74_BOK-01          SVSVESVVSDAFLSVATEILSLGITWGKVVAIFAVAGGSGGGLCPAGSSS
                       :*: *********:**:**:* *:******:::****. .          

A0A3B1IPM7_BOK-01      --------VDCVRHGHPAMVHTIVDCMGEFVRKSLVSWLKRRGGWTDITK
W5KF74_BOK-01          HDTHYSGQPGGVRPEEPGALAEEERRLGRHFKVC-----DERGHYTSVPL
                                . **   *. :      :* ... .     . ** :*.:. 

A0A3B1IPM7_BOK-01      CV---VNTDPSFRSHWLVAAACTC----------VHYLKAVVFYLLREK-
W5KF74_BOK-01          DVCSSINLEARCEDHVYLPDEVTVEAVAVNTAPGLELLGSLRLLMISELY
                        *   :* :.   .*  :.   *           :  * :: : :: *  

© 1998-2019