Dataset for protein BAX-like of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B1JGN3_BAX-01      -MAAQGEGYAVN-----------------LLRIGYRLLINFISERLQRTL
W5KJ43_BAX-01          -MADSGDSGGNEDSELLGATGGEDVVDDQIVEQGALVLRGYVLRRLSTE-
W5KJ43_BAX-02          -MADSGDSGGNEDSELLGATGGEDVVDDQIVEQGALVLRGYVLRRLSTE-
W5KCK0_BAX-01          -MFVCSVFKGNG--------------NEQLLDLGASLLKDFIYQRVQRHG
A0A3B1IPM7_BOK-01      MKGMEVLRRSSVFAAEVMEVFERSPTDKELVSQSKVLCRDYIHSRLNRA-
W5KF74_BOK-01          -----------------MDLMDRGPSEKELVFQSKILCRDFIYSRITRE-
                                                    ::  .  :  .::  *:    

A0A3B1JGN3_BAX-01      EIDAAVTKNLLDE-TEEVPDPNIKKVGQRLQQFGDELD-------NDTKL
W5KJ43_BAX-01          NPDVRVSRVDLGGRPDEGDDPQIKVVVEQLLRIADDLN-------RNTEL
W5KJ43_BAX-02          NPDVRVSRVDLGGRPDEGDDPQIKVVVEQLLRIADDLN-------RNTEL
W5KCK0_BAX-01          DSNALVTRNQLGG--TELCDPSHKRLAQCLQQIGDELD-------SNVQL
A0A3B1IPM7_BOK-01      --GIGWSKADHGL-SA---GGSLGEVSSVLLWLGDELEYLRPNVYRNVAR
W5KF74_BOK-01          --GLNWSKVESSL-PVPVPDGALGDVSMVLLKLGDELEYMRPYIYRNVAK
                         .   :.   .       .     :   * .:.*:*:        :.  

A0A3B1JGN3_BAX-01      KEMINNLM--PTKEVFLKIAYEIFSDWKFNWGRVVALFYFACEFV-----
W5KJ43_BAX-01          QHLISTVQANCAQDVFMTVARTIFTDG-INWGRIVALFHLAYQLI-----
W5KJ43_BAX-02          QHLISTVQANCAQDVFMTVARTIFTDG-INWGRIVALFHLAYQLI-----
W5KCK0_BAX-01          QSMINDSALQPTQDVFVKVACEIFSDGKFNWGRVVALFYFACRLV-----
A0A3B1IPM7_BOK-01      QLNITVASESVVSDAFLAVAAEIFSTG-VTWGKVVSLYAVAGALA-----
W5KF74_BOK-01          QLSISVSVESVVSDAFLSVATEILSLG-ITWGKVVAIFAVAGGSGGGLCP
                       :  *.      ..:.*: :*  *::   ..**.:*::: .*         

A0A3B1JGN3_BAX-01      ------------------KMVPDIISNIISWT-LEFMRDHVIAWISGQGG
W5KJ43_BAX-01          -------------YNALTQNHLEIIKNIISWV-LQYIRQHVSAWIRQQGG
W5KJ43_BAX-02          -------------YNTLREETIMSNQQTLSNLPRELVRTAVVEIVSTTRF
W5KCK0_BAX-01          -------------IKAVLTKLPDIIRTIINWT-VDYLREHVINWIREQGG
A0A3B1IPM7_BOK-01      -------------VDCVRHGHPAMVHTIVDCM-GEFVRKSLVSWLKRRGG
W5KF74_BOK-01          AGSSSHDTHYSGQPGGVRPEEPGALAEEERRL-GRHFKVC-----DERGH
                                                           ..            

A0A3B1JGN3_BAX-01      WDAILSQ----IEAPSWTTVTAFVAGVLTT-----------------ALI
W5KJ43_BAX-01          WEGVIR------SVSRWRTVTVIAAVAFIA-----------------AAV
W5KJ43_BAX-02          LFWFQT------SLTPW-------GKCFLC-----------------LLL
W5KCK0_BAX-01          WEGIRSY----FGTPTWQTVGVFLAGVLTT-----------------VLV
A0A3B1IPM7_BOK-01      WTDITKCV---VNTDPSFRSHWLVAAACTC----------VHYLKAVVFY
W5KF74_BOK-01          YTSVPLDVCSSINLEARCEDHVYLPDEVTVEAVAVNTAPGLELLGSLRLL
                          .                                              

A0A3B1JGN3_BAX-01      VNKM--
W5KJ43_BAX-01          YWKRSR
W5KJ43_BAX-02          FFSEAK
W5KCK0_BAX-01          MRKM--
A0A3B1IPM7_BOK-01      LLREK-
W5KF74_BOK-01          MISELY
                             

© 1998-2019