Dataset for protein Bax of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B1JGN3_BAX-01      MAAQGEGYAVN-----------------LLRIGYRLLINFISERLQRTLE
W5KJ43_BAX-01          MADSGDSGGNEDSELLGATGGEDVVDDQIVEQGALVLRGYVLRRLSTE-N
W5KJ43_BAX-02          MADSGDSGGNEDSELLGATGGEDVVDDQIVEQGALVLRGYVLRRLSTE-N
W5KCK0_BAX-01          MFVCSVFKGNG--------------NEQLLDLGASLLKDFIYQRVQRHGD
                       *   .   .                   ::  *  :* .::  *:.   :

A0A3B1JGN3_BAX-01      IDAAVTKNLLDE-TEEVPDPNIKKVGQRLQQFGDELDNDTKLKEMINNLM
W5KJ43_BAX-01          PDVRVSRVDLGGRPDEGDDPQIKVVVEQLLRIADDLNRNTELQHLISTVQ
W5KJ43_BAX-02          PDVRVSRVDLGGRPDEGDDPQIKVVVEQLLRIADDLNRNTELQHLISTVQ
W5KCK0_BAX-01          SNALVTRNQLGG--TELCDPSHKRLAQCLQQIGDELDSNVQLQSMINDSA
                        :. *:.  *.    *  **. * : : * .:.*:*: :.:*: :*.   

A0A3B1JGN3_BAX-01      --PTKEVFLKIAYEIFSDWKFNWGRVVALFYFACEFV-----KMVPDIIS
W5KJ43_BAX-01          ANCAQDVFMTVARTIFTDG-INWGRIVALFHLAYQLIYNALTQNHLEIIK
W5KJ43_BAX-02          ANCAQDVFMTVARTIFTDG-INWGRIVALFHLAYQLIYNTLREETIMSNQ
W5KCK0_BAX-01          LQPTQDVFVKVACEIFSDGKFNWGRVVALFYFACRLVIKAVLTKLPDIIR
                          :::**:.:*  **:*  :****:****::*  ::             

A0A3B1JGN3_BAX-01      NIISWT-LEFMRDHVIAWISGQGGWDAILSQIEAPSWTTVTAFVAGVLTT
W5KJ43_BAX-01          NIISWV-LQYIRQHVSAWIRQQGGWEGVIR--SVSRWRTVTVIAAVAFIA
W5KJ43_BAX-02          QTLSNLPRELVRTAVVEIVSTTRFLFWFQT--SLTPW-------GKCFLC
W5KCK0_BAX-01          TIINWT-VDYLREHVINWIREQGGWEGIRSYFGTPTWQTVGVFLAGVLTT
                         :..   : :*  *   :        .      . *       .  :  

A0A3B1JGN3_BAX-01      ALIVNKM--
W5KJ43_BAX-01          AAVYWKRSR
W5KJ43_BAX-02          LLLFFSEAK
W5KCK0_BAX-01          VLVMRKM--
                         :  .   

© 1998-2019