Dataset for protein Bok of organism Astatotilapia calliptera

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8R8S7_BOK-01      MEMLRRSSVFASE---VFDRSPTDKELVSQAKALCREYIHSRLNRAGIGW
A0A3P8R3S9_BOK-03      MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGW
A0A3P8R3S9_BOK-06      MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGW
A0A3P8R3S9_BOK-01      MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGW
A0A3P8R3S9_BOK-02      MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGW
A0A3P8R3S9_BOK-05      MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGW
A0A3P8R3S9_BOK-04      MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGW
                       **:********:*   ***** *:****:*:*****:** ****. *:**

A0A3P8R8S7_BOK-01      SKPEHGLAASGGTLGEISSVLLWLGDELEYLRPNVYRNVARQLNITVASE
A0A3P8R3S9_BOK-03      SKTELNFSPSNTALAEVSMVLLCLGDELECIQPSLYRNVARQLNISVAME
A0A3P8R3S9_BOK-06      SKTELNFSPSNTALAEVSMVLLCLGDELECIQPSLYRNVARQLNISVAME
A0A3P8R3S9_BOK-01      SKTELNFSPSNTALAEVSMVLLCLGDELECIQPSLYRNVARQLNISVAME
A0A3P8R3S9_BOK-02      SKTELNFSPSNTALAEVSMVLLCLGDELECIQPSLYRNVARQLNISVAME
A0A3P8R3S9_BOK-05      SKTELNFSPSNTALAEVSMVLLCLGDELECIQPSLYRNVARQLNISVAME
A0A3P8R3S9_BOK-04      SKTELNFSPSNTALAEVSMVLLCLGDELECIQPSLYRNVARQLNISVAME
                       **.* .::.*. :*.*:* *** ****** :.*.:**********:** *

A0A3P8R8S7_BOK-01      SVVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTI
A0A3P8R3S9_BOK-03      NMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHIL
A0A3P8R3S9_BOK-06      NMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHIL
A0A3P8R3S9_BOK-01      NMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHIL
A0A3P8R3S9_BOK-02      NMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHIL
A0A3P8R3S9_BOK-05      NMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHIL
A0A3P8R3S9_BOK-04      NMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHIL
                       .:*****:.**::***:*:*******::************:**** ** :

A0A3P8R8S7_BOK-01      VDCMGEFVRKSLTSWLKKRGGWVDVTKCVVSTDPN---------------
A0A3P8R3S9_BOK-03      VDSLGQFVRKFLVPWLKRRGGWVSF---CLSKILGKHEMHKKLTFEIQQR
A0A3P8R3S9_BOK-06      VDSLGQFVRKFLVPWLKRRGGWVSF---CLSKILGKHEMHKKLTFEIQQR
A0A3P8R3S9_BOK-01      VDSLGQFVRKFLVPWLKRRGGWVSF---CLSKILGKHEMHKKLTFEIQQR
A0A3P8R3S9_BOK-02      VDSLGQFVRKFLVPWLKRRGGWVSF---CLSKILGKHEMHKKLTFEIQQR
A0A3P8R3S9_BOK-05      VDSLGQFVRKFLVPWLKRRGGWVSF---CLSKILGKHEMHKKLTFEIQQR
A0A3P8R3S9_BOK-04      VDSLGQFVRKFLVPWLKRRGGWVEITKCVVKKDFCPEENWLSSAFESLKC
                       **.:*:**** *..***.*****..    :..                  

A0A3P8R8S7_BOK-01      --FCSHWLVSAVCAFGHYLKTVVLHLLREK
A0A3P8R3S9_BOK-03      FAFASFVCVCAGVGWGFEFDALLCA-----
A0A3P8R3S9_BOK-06      FAFASFVCVCAGVGWGFEFDALLCA-----
A0A3P8R3S9_BOK-01      FAFASFVCVCAGVGWGFEFDALLCA-----
A0A3P8R3S9_BOK-02      FAFASFVCVCAGVGWGFEFDALLCA-----
A0A3P8R3S9_BOK-05      FAFASFVCVCAGVGWGFEFDALLCA-----
A0A3P8R3S9_BOK-04      FLTTMYVYIMKEP-----------------
                            .  :                     

© 1998-2019