Dataset for protein BAX-like of organism Astatotilapia calliptera

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8N5H5_BAX-01      MMVRTEYLNCGRTQSKTDKYSSVGRFLGEYLHLWDFCEACLRTAGPVATI
A0A3P8N5H5_BAX-02      ----------MADGRGGQNPEQEPR-----GAAGG---------------
A0A3P8NNI6_BAX-01      ----------MASHPGGGDQGSSSYRQQIKYIYFD---------------
A0A3P8NNI6_BAX-02      ----------MASHPGGGD---------------Q---------------
A0A3P8NNI6_BAX-03      ----------MLIYQHLSHLMSV-------YLCLS---------------
A0A3P8NNW3_BAX-01      ----------MLIYQHLSHLMSV-------YLCLS---------------
A0A3P8R8S7_BOK-01      ----------MEMLRRSSVFASE---------VFD---------------
A0A3P8R3S9_BOK-03      ----------MEVLRRSSVFAAEV------LDVFD---------------
A0A3P8R3S9_BOK-06      ----------MEVLRRSSVFAAEV------LDVFD---------------
A0A3P8R3S9_BOK-01      ----------MEVLRRSSVFAAEV------LDVFD---------------
A0A3P8R3S9_BOK-02      ----------MEVLRRSSVFAAEV------LDVFD---------------
A0A3P8R3S9_BOK-05      ----------MEVLRRSSVFAAEV------LDVFD---------------
A0A3P8R3S9_BOK-04      ----------MEVLRRSSVFAAEV------LDVFD---------------
                                                                         

A0A3P8N5H5_BAX-01      LPYHFRVLLLKGGFPQTRFGSMADGRGGQNPEQEPRGAAGGDDVVDDSIL
A0A3P8N5H5_BAX-02      -----------------------------------------DDVVDDSIL
A0A3P8NNI6_BAX-01      -----------------------------------------SDSVGGSPI
A0A3P8NNI6_BAX-02      -----------------------------------------GNS-GDQIL
A0A3P8NNI6_BAX-03      -----------------------------------------GNS-GDQIL
A0A3P8NNW3_BAX-01      -----------------------------------------WNS-GDQIL
A0A3P8R8S7_BOK-01      -----------------------------------------RSPTDKELV
A0A3P8R3S9_BOK-03      -----------------------------------------RSLTEKELV
A0A3P8R3S9_BOK-06      -----------------------------------------RSLTEKELV
A0A3P8R3S9_BOK-01      -----------------------------------------RSLTEKELV
A0A3P8R3S9_BOK-02      -----------------------------------------RSLTEKELV
A0A3P8R3S9_BOK-05      -----------------------------------------RSLTEKELV
A0A3P8R3S9_BOK-04      -----------------------------------------RSLTEKELV
                                                                 .    . :

A0A3P8N5H5_BAX-01      EEGAVVFRGYVIAHINTEEPS-RHVTSEDLGGRPDEQQDPQVKEVVEQLR
A0A3P8N5H5_BAX-02      EEGAVVFRGYVIAHINTEEPS-RHVTSEDLGGRPDEQQDPQVKEVVEQLR
A0A3P8NNI6_BAX-01      DTDNV---AFIYERVQRQGDGNKAVTREQLGGSQ--LTDPKHKKLAQCLQ
A0A3P8NNI6_BAX-02      EVGTILLQDFIYERVQRQGDGNKAVTREQLGGSQ--LTDPKHKKLAQCLQ
A0A3P8NNI6_BAX-03      EVGTILLQDFIYERVQRQGDGNKAVTREQLGGSQ--LTDPKHKKLAQCLQ
A0A3P8NNW3_BAX-01      EVGTILLQDFIYERVQRQRDGNSAVTREQLDGSQ--LTDPKHKKLAQCLQ
A0A3P8R8S7_BOK-01      SQAKALCREYIHSRLNRAGIG---WSKPEHGLAA---SGGTLGEISSVLL
A0A3P8R3S9_BOK-03      TQSKALCRDYILSRLNQNGLG---WSKTELNFSP---SNTALAEVSMVLL
A0A3P8R3S9_BOK-06      TQSKALCRDYILSRLNQNGLG---WSKTELNFSP---SNTALAEVSMVLL
A0A3P8R3S9_BOK-01      TQSKALCRDYILSRLNQNGLG---WSKTELNFSP---SNTALAEVSMVLL
A0A3P8R3S9_BOK-02      TQSKALCRDYILSRLNQNGLG---WSKTELNFSP---SNTALAEVSMVLL
A0A3P8R3S9_BOK-05      TQSKALCRDYILSRLNQNGLG---WSKTELNFSP---SNTALAEVSMVLL
A0A3P8R3S9_BOK-04      TQSKALCRDYILSRLNQNGLG---WSKTELNFSP---SNTALAEVSMVLL
                                ::  .::    .    :  : .       .    ::   * 

A0A3P8N5H5_BAX-01      KIADSLN-------RNAELQRLINQVQGNCVQDVFMAVARNIFADGI-NW
A0A3P8N5H5_BAX-02      KIADSLN-------RNAELQRLINQVQGNCVQDVFMAVARNIFADGI-NW
A0A3P8NNI6_BAX-01      QIGDELD-------GNVELQRMINDSSLCPTREVFMRVAYEIFSDGIFNW
A0A3P8NNI6_BAX-02      QIGDELD-------GNVELQRMINDSSLCPTREVFMRVAYEIFSDGIFNW
A0A3P8NNI6_BAX-03      QIGDELD-------GNVELQRMINDSSLCPTREVFMRVAYEIFSDGIFNW
A0A3P8NNW3_BAX-01      HIGDELD-------GNVELQRMINNSSLCPTRKVFMRVASEIFSDGIFNW
A0A3P8R8S7_BOK-01      WLGDELEYLRPNVYRNVARQLNITVASESVVSDAFLAVAADIFSTGV-TW
A0A3P8R3S9_BOK-03      CLGDELECIQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGI-TW
A0A3P8R3S9_BOK-06      CLGDELECIQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGI-TW
A0A3P8R3S9_BOK-01      CLGDELECIQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGI-TW
A0A3P8R3S9_BOK-02      CLGDELECIQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGI-TW
A0A3P8R3S9_BOK-05      CLGDELECIQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGI-TW
A0A3P8R3S9_BOK-04      CLGDELECIQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGI-TW
                        :.*.*:        *.  *  *.      . ..*: ** :**: *: .*

A0A3P8N5H5_BAX-01      GRVVALFHLACKLIHKAITANHLENIQMIISWVLQVIREQVYSWLVAQGG
A0A3P8N5H5_BAX-02      GRVVALFHLACKLIHKAITANHLENIQMIISWVLQVIREQVYSWLVAQGG
A0A3P8NNI6_BAX-01      GRVVALFYFACRLVIKALVTQIPDIIRTIISWTIDYLREHVINWIREQGG
A0A3P8NNI6_BAX-02      GRVVALFYFACRLVIKALVTQIPDIIRTIISWTIDYLREHVINWIREQGG
A0A3P8NNI6_BAX-03      GRVVALFYFACRLVIKALVTQIPDIIRTIISWTIDYLREHVINWIREQGG
A0A3P8NNW3_BAX-01      GRVVALFYFACRLVIKVRETAIAD---SPFEWVLDFVR--VLNFVR----
A0A3P8R8S7_BOK-01      GKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLTSWLKKRGG
A0A3P8R3S9_BOK-03      GKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRKFLVPWLKRRGG
A0A3P8R3S9_BOK-06      GKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRKFLVPWLKRRGG
A0A3P8R3S9_BOK-01      GKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRKFLVPWLKRRGG
A0A3P8R3S9_BOK-02      GKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRKFLVPWLKRRGG
A0A3P8R3S9_BOK-05      GKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRKFLVPWLKRRGG
A0A3P8R3S9_BOK-04      GKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRKFLVPWLKRRGG
                       *.**::: .*  *  .             ..   : :*  :  ::     

A0A3P8N5H5_BAX-01      WEGV--------------------------IRGFSRWRTAAMVASVVLVV
A0A3P8N5H5_BAX-02      WEGV--------------------------IRGFSRWRTAAMVASVVLVV
A0A3P8NNI6_BAX-01      WEGI------------------------RSYFGTPTWQTVGVFLAGVLTT
A0A3P8NNI6_BAX-02      WEGI------------------------RSYFGTPTWQTVGVFLAGVLTT
A0A3P8NNI6_BAX-03      WEGI------------------------RSYFGTPTWQTVGVFLAGVLTT
A0A3P8NNW3_BAX-01      --------------------------------------------------
A0A3P8R8S7_BOK-01      WVDVTKCVVSTDPN-----------------FCSHWLVSAVCAFGHYLKT
A0A3P8R3S9_BOK-03      WVSF---CLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDA
A0A3P8R3S9_BOK-06      WVSF---CLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDA
A0A3P8R3S9_BOK-01      WVSF---CLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDA
A0A3P8R3S9_BOK-02      WVSF---CLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDA
A0A3P8R3S9_BOK-05      WVSF---CLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDA
A0A3P8R3S9_BOK-04      WVEITKCVVKKDFCPEENWLSSAFESLKCFLTTMYVYIMKEP--------
                                                                         

A0A3P8N5H5_BAX-01      AFVYYRKVR
A0A3P8N5H5_BAX-02      AFVYYRKVR
A0A3P8NNI6_BAX-01      VLVIRKM--
A0A3P8NNI6_BAX-02      VLVIRKM--
A0A3P8NNI6_BAX-03      VLVIRKM--
A0A3P8NNW3_BAX-01      VLDFATV--
A0A3P8R8S7_BOK-01      VVLHLLREK
A0A3P8R3S9_BOK-03      LLCA-----
A0A3P8R3S9_BOK-06      LLCA-----
A0A3P8R3S9_BOK-01      LLCA-----
A0A3P8R3S9_BOK-02      LLCA-----
A0A3P8R3S9_BOK-05      LLCA-----
A0A3P8R3S9_BOK-04      ---------
                                

© 1998-2019