Dataset for protein Bax of organism Astatotilapia calliptera

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8N5H5_BAX-01      MMVRTEYLNCGRTQSKTDKYSSVGRFLGEYLHLWDFCEACLRTAGPVATI
A0A3P8N5H5_BAX-02      --------------------------------------------------
A0A3P8NNI6_BAX-01      --------------------------------------------------
A0A3P8NNI6_BAX-02      --------------------------------------------------
A0A3P8NNI6_BAX-03      --------------------------------------------------
A0A3P8NNW3_BAX-01      --------------------------------------------------
                                                                         

A0A3P8N5H5_BAX-01      LPYHFRVLLLKGGFPQTRFGSMADGRGGQNPEQEPRGAAG-----GDDVV
A0A3P8N5H5_BAX-02      ---------------------MADGRGGQNPEQEPRGAAG-----GDDVV
A0A3P8NNI6_BAX-01      ---------------------MASHPGGGDQGSSSYRQQIKYIYFDSDSV
A0A3P8NNI6_BAX-02      ---------------------MASHPGGGD---------------QGNS-
A0A3P8NNI6_BAX-03      ---------------------MLIYQHLSHLMSV-------YLCLSGNS-
A0A3P8NNW3_BAX-01      ---------------------MLIYQHLSHLMSV-------YLCLSWNS-
                                            *                         :  

A0A3P8N5H5_BAX-01      DDSILEEGAVVFRGYVIAHINTE-EPSRHVTSEDLGGRPDEQQDPQVKEV
A0A3P8N5H5_BAX-02      DDSILEEGAVVFRGYVIAHINTE-EPSRHVTSEDLGGRPDEQQDPQVKEV
A0A3P8NNI6_BAX-01      GGSPIDTDNV---AFIYERVQRQGDGNKAVTREQLGG--SQLTDPKHKKL
A0A3P8NNI6_BAX-02      GDQILEVGTILLQDFIYERVQRQGDGNKAVTREQLGG--SQLTDPKHKKL
A0A3P8NNI6_BAX-03      GDQILEVGTILLQDFIYERVQRQGDGNKAVTREQLGG--SQLTDPKHKKL
A0A3P8NNW3_BAX-01      GDQILEVGTILLQDFIYERVQRQRDGNSAVTREQLDG--SQLTDPKHKKL
                       ... :: . :    ::  .:: : : .  ** *:*.*  .:  **: *::

A0A3P8N5H5_BAX-01      VEQLRKIADSLNRNAELQRLINQVQGNCVQDVFMAVARNIFADGI-NWGR
A0A3P8N5H5_BAX-02      VEQLRKIADSLNRNAELQRLINQVQGNCVQDVFMAVARNIFADGI-NWGR
A0A3P8NNI6_BAX-01      AQCLQQIGDELDGNVELQRMINDSSLCPTREVFMRVAYEIFSDGIFNWGR
A0A3P8NNI6_BAX-02      AQCLQQIGDELDGNVELQRMINDSSLCPTREVFMRVAYEIFSDGIFNWGR
A0A3P8NNI6_BAX-03      AQCLQQIGDELDGNVELQRMINDSSLCPTREVFMRVAYEIFSDGIFNWGR
A0A3P8NNW3_BAX-01      AQCLQHIGDELDGNVELQRMINNSSLCPTRKVFMRVASEIFSDGIFNWGR
                       .: *.:*.*.*: *.****:**: .   ...*** ** :**:*** ****

A0A3P8N5H5_BAX-01      VVALFHLACKLIHKAITANHLENIQMIISWVLQVIREQVYSWLVAQGGWE
A0A3P8N5H5_BAX-02      VVALFHLACKLIHKAITANHLENIQMIISWVLQVIREQVYSWLVAQGGWE
A0A3P8NNI6_BAX-01      VVALFYFACRLVIKALVTQIPDIIRTIISWTIDYLREHVINWIREQGGWE
A0A3P8NNI6_BAX-02      VVALFYFACRLVIKALVTQIPDIIRTIISWTIDYLREHVINWIREQGGWE
A0A3P8NNI6_BAX-03      VVALFYFACRLVIKALVTQIPDIIRTIISWTIDYLREHVINWIREQGGWE
A0A3P8NNW3_BAX-01      VVALFYFACRLVIKVRETAIAD---SPFEWVLDFVR--VLNFVR------
                       *****::**.*: *.  :   :     :.*.:: :*  * .::       

A0A3P8N5H5_BAX-01      GVIR--GFSRWRTAAMVASVVLVVAFVYYRKVR
A0A3P8N5H5_BAX-02      GVIR--GFSRWRTAAMVASVVLVVAFVYYRKVR
A0A3P8NNI6_BAX-01      GIRSYFGTPTWQTVGVFLAGVLTTVLVIRKM--
A0A3P8NNI6_BAX-02      GIRSYFGTPTWQTVGVFLAGVLTTVLVIRKM--
A0A3P8NNI6_BAX-03      GIRSYFGTPTWQTVGVFLAGVLTTVLVIRKM--
A0A3P8NNW3_BAX-01      ------------------------VLDFATV--
                                               .:       

© 1998-2019