Dataset for protein BAX-like of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5D7G1_BAK1-01      -------------MASGQGPGPPRQECGEPDSPSASEEQVARDTEEVFQS
A0A2K5DQ30_BOK-01       MEVLRRSSVFAAEIMDAFDRSPTDKE--------------LVAQP-----
A0A2K5D885_BAX-01       --------------MDGSGEQPRGEG--------------PTSSEQIMKT
A0A2K5D885_BAX-04       --------------MDGSGEQPRGEG--------------PTSSEQIMKT
A0A2K5D885_BAX-03       --------------MDGSGEQPRGEG--------------PTS-------
A0A2K5D885_BAX-02       --------------MDGSGEQPRGEG--------------EFHPG-----
                                       .. .  *  :                         

A0A2K5D7G1_BAK1-01      YVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAIIGDDINR
A0A2K5DQ30_BOK-01       ------KYVHARLLAPERAAPSGRPAEVVAALQAAPGRDELEMIRPSVYR
A0A2K5D885_BAX-01       GALLLQGFIQDRAGRIGGETPELALDPVPQDASTKKLSECLKRIGDELDS
A0A2K5D885_BAX-04       GALLLQGFIQDRAGRIGGETPELALDPVPQDASTKKLSECLKRIGDELDS
A0A2K5D885_BAX-03       -------------------------------------SEQIMKTGALL--
A0A2K5D885_BAX-02       ----------------SSRTPELALDPVPQDASTKKLSECLKRIGDELDS
                                                                :      :  

A0A2K5D7G1_BAK1-01      RYDSEFQTMLQHLQPTAENAYEYFTKIASSLFESG-INWGRVVALLGFGY
A0A2K5DQ30_BOK-01       --NVARQLHISLQS--EPVVTDAFLAVAGHIFSAG-ITWGKVVSLYAVAA
A0A2K5D885_BAX-01       --NMELQRMIAAVD--TDSPREVFFRVAADMFSDGNFNWGRVVALFYFAS
A0A2K5D885_BAX-04       --NMELQRMIAAVD--TDSPREVFFRVAADMFSDGNFNWGRVVALFYFAS
A0A2K5D885_BAX-03       -----LQGMIAAVD--TDSPREVFFRVAADMFSDGNFNWGRVVALFYFAS
A0A2K5D885_BAX-02       --NMELQRMIAAVD--TDSPREVFFRVAADMFSDGNFNWGRVVALFYFAS
                              *  :   .       : *  :*. :*. * :.**.**:*  .. 

A0A2K5D7G1_BAK1-01      RLALHVYQRGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALDLGNG
A0A2K5DQ30_BOK-01       GLAVDCVRQAQPAMVHALVDCLGEF-VRKTLATWLRRRGGWTDVLKCVVS
A0A2K5D885_BAX-01       KLVLKALCAKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWDGLLSYFFG
A0A2K5D885_BAX-04       KLVLKALCAKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWVTLLPL---
A0A2K5D885_BAX-03       KLVLKALCAKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWDGLLSYFFG
A0A2K5D885_BAX-02       KLVLKALCAKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWDGLLSYFFG
                         *.:       . ::  :     :* :.  :  *:  .***   *     

A0A2K5D7G1_BAK1-01      P--------ILNVLVVLGVVLLGQFVVRRFFKS
A0A2K5DQ30_BOK-01       TDPGLRSHWLLAALCSFGRFLKAAFFVLLPER-
A0A2K5D885_BAX-01       T-----PTWQTVTIFVAG-VLTASLTIWKNMG-
A0A2K5D885_BAX-04       ------PIFRSSDVVSNA-F-------------
A0A2K5D885_BAX-03       T-----PTWQTVTIFVAG-VLTASLTIWKNMG-
A0A2K5D885_BAX-02       T-----PTWQTVTIFVAG-VLTASLTIWKNMG-
                                     :   . .             

© 1998-2019