Dataset for protein BAX-like of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5D7G1_BAK1-01      MASGQGPGPPRQECGEPDSPSASEEQVARDTEEVFQSYVFYRHRQEQEAE
A0A2K5DQ30_BOK-01       ------MEVLRRSSVFAAEIMDAFDRSPTDKELVAQPKYVHARLLAPERA
A0A2K5D846_BAX-04       ---------------MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRA
A0A2K5D846_BAX-01       ---------------MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRA
                                          .   .    . ..* : :.  .  .    :  

A0A2K5D7G1_BAK1-01      GAAAPADPEMVSLSLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL
A0A2K5DQ30_BOK-01       APSGRPAEVVAALQAAPGRD------ELEMIRPSVYRNVARQLHISLQSE
A0A2K5D846_BAX-04       GRIGGETPEL-ALDPVPQDA------STKKLSECL-KRIGDELDSNMELQ
A0A2K5D846_BAX-01       GRIGGETPEL-ALDPVPQDA------STKKLSECL-KRIGDELDSNMELQ
                        .  .     : :*.  *         .   :   : ..   ::   ::  

A0A2K5D7G1_BAK1-01      QPTA----ENAYEYFTKIASSLFESG-INWGRVVALLGFGYRLALHVYQR
A0A2K5DQ30_BOK-01       PVVT--------DAFLAVAGHIFSAG-ITWGKVVSLYAVAAGLAVDCVRQ
A0A2K5D846_BAX-04       RMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCA
A0A2K5D846_BAX-01       RMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCA
                           :        : *  :*. :*. * :.**.**:*  ..  *.:     

A0A2K5D7G1_BAK1-01      GLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALDL--GNGPILNVLV
A0A2K5DQ30_BOK-01       AQPAMVHALVDCLGEF-VRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHW
A0A2K5D846_BAX-04       KVPELIRTIMGWTLDF-LRERLLGWIQDQGGWVTLLPL-----PIFRSSD
A0A2K5D846_BAX-01       KVPELIRTIMGWTLDF-LRERLLGWIQDQGGWDGLLSYFFGT-PTWQTVT
                          . ::  :     :* :.  :  *:  .***   *       *  .   

A0A2K5D7G1_BAK1-01      VLGV-VLLGQFVVRRFFKS----
A0A2K5DQ30_BOK-01       LLAALCSFGRFLKAAFFVLLPER
A0A2K5D846_BAX-04       VVSN-----AF------------
A0A2K5D846_BAX-01       IFVA-----GVLTASLTIWKNMG
                        :.        .            

© 1998-2019