Dataset for protein Bax of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5D885_BAX-01      MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIGGETPELALDPV
A0A2K5D885_BAX-04      MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIGGETPELALDPV
A0A2K5D885_BAX-03      MDGSGEQPRGEGPTS-----------------------------------
A0A2K5D885_BAX-02      MDGSGEQPRGEGEFHPG---------------------SSRTPELALDPV
                       ************                                      

A0A2K5D885_BAX-01      PQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
A0A2K5D885_BAX-04      PQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
A0A2K5D885_BAX-03      ---------SEQIMKTGALL-----LQGMIAAVDTDSPREVFFRVAADMF
A0A2K5D885_BAX-02      PQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
                                ** : . *  *     ** **********************

A0A2K5D885_BAX-01      SDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLG
A0A2K5D885_BAX-04      SDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLG
A0A2K5D885_BAX-03      SDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLG
A0A2K5D885_BAX-02      SDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLG
                       **************************************************

A0A2K5D885_BAX-01      WIQDQGGWDGLLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG
A0A2K5D885_BAX-04      WIQDQGGWVTLLPL----PIFRSSDVVSNAF------------
A0A2K5D885_BAX-03      WIQDQGGWDGLLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG
A0A2K5D885_BAX-02      WIQDQGGWDGLLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG
                       ********  **.     * :.:  :.  ..            

© 1998-2019