Dataset for protein BAX-like of organism Anolis carolinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H9G9C2_BAX-01       ------------------------------------------------------------
H9GPC1_BAX-01       MAAAAADPGRSREAGAPPRKAGTSS-------DQILQTGTVLLKGFIWDRVQSCGDSERI
G1K8X4_BOK-01       ------------MKMDVLRRSSVFAAEVMEVFDRTPTDKELVSQAKVLCRDFIHSRLIRA
G1KSN2_BAK1-01      MASRNGNDPTDRRRTEIRRPSMEIALE-----DQVAQETEEVFQSYAFYRYQQEREQTEG
                                                                                

H9G9C2_BAX-01       --------GAEASPDAAAVTSLQDCMFRIWQELSS--NRDLTSMVESATGKNPL-----E
H9GPC1_BAX-01       QATLAELKESESRICDPKTKQLSECLRRIGDELDG--NMELQSMIEQVQVYPPK-----E
G1K8X4_BOK-01       GIGWNKPEHSVPV-PGGKLAEVSNILLRLGDELEYIRPNLYRNVARQLNISLHSETVVTD
G1KSN2_BAK1-01      DVPHDPEIAAIPHEPNSTNCQVGRRLATIGDDINARYDKEFSEMLKSLQ---PTKDNAYE
                             : .        .:   :  : :::.        .:  .            :

H9G9C2_BAX-01       VLADVSEHLFADG-INWGRIVVFFYFAFRVIAQVKKKEAKNPESIEDVVSWAMTFL-QNH
H9GPC1_BAX-01       VFFRVAAEMFSDGTFNWGRVVALFYFACKLVLKAICTKL--PELIKTIISWTMEYI-KNH
G1K8X4_BOK-01       AFLAVATQIFSSG-ITWGKIVSLYAVAAGLAVDCVRHAQ--PAMVHTIVDCLGEFV-RKT
G1KSN2_BAK1-01      YFIRIASSLFESG-INWGRVIALLGFGYRMAIHVYQHGM--TGFLRRIARYMADFVLRNR
                     :  ::  :* .* :.**.:: :  ..  :           .  :  :      :: .: 

H9G9C2_BAX-01       LANWIQQQGGWEGLLSYFGTPT------WQTIAVFAAGVLTASLTFWKMS--
H9GPC1_BAX-01       VLTWIQAQGGWEGLLSYFGTPT------WQTIAVFAAGVLTASLTFWKMS--
G1K8X4_BOK-01       LVTWMKRRGGWSDITKCVVNTDPNLRSHWLVAAICSFGHFLKAIFFVLLPER
G1KSN2_BAK1-01      IARWIAQQGGW---VAALDLSNVYLKYVLIVAAVILLGQFVVRRFFNP----
                    :  *:  .***      .  .         . *:   * :     *      

© 1998-2019