Dataset for protein Bax of organism Anolis carolinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H9G9C2_BAX-01      ------------GAEASPDAAAVTS-----------------------------------
H9GPC1_BAX-01      MAAAAADPGRSREAGAPPRKAGTSSDQILQTGTVLLKGFIWDRVQSCGDSERIQATLAEL
                                * *.*  *..:*                                   

H9G9C2_BAX-01      --------------LQDCMFRIWQELSSNRDLTSMVESATGKNPLEVLADVSEHLFADG-
H9GPC1_BAX-01      KESESRICDPKTKQLSECLRRIGDELDGNMELQSMIEQVQVYPPKEVFFRVAAEMFSDGT
                                 *.:*: ** :**..* :* **:*..    * **:  *:  :*:** 

H9G9C2_BAX-01      INWGRIVVFFYFAFRVIAQVKKKEAKNPESIEDVVSWAMTFLQNHLANWIQQQGGWEGLL
H9GPC1_BAX-01      FNWGRVVALFYFACKLV--LKAICTKLPELIKTIISWTMEYIKNHVLTWIQAQGGWEGLL
                   :****:*.:**** .::  :*   :* ** *: ::**:* :::**: .*** ********

H9G9C2_BAX-01      SYFGTPTWQTIAVFAAGVLTASLTFWKMS
H9GPC1_BAX-01      SYFGTPTWQTIAVFAAGVLTASLTFWKMS
                   *****************************

© 1998-2019