Dataset for protein BAX-like of organism Anas platyrhynchos platyrhynchos

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U3ISP2_BOK-01           --MEVLRRSSVFAAEVMEVFDRSPTDKELVSQAKALC-------------
A0A493TW00_BAK1-02      MVWGWVSNFFFFFSVSLLLFPPPPRPCSLPSPAPRRCAPGRRQEGSGGDG
A0A493TW00_BAK1-01      MVWGWVSNFFFFFSVSLLLFPPPPRPCSLPSPAPRRCAPGRRQEGSGGDG
                             : .  .* :  : :*  .*   .* * *   *             

U3ISP2_BOK-01           ---------------------RDYINSRLVRAGVSWSKPECNAPVPGGKL
A0A493TW00_BAK1-02      AAPRRDALGLPGTPPGPPGPRREPVKLILPSISAMASGNDGDPPRAHGRR
A0A493TW00_BAK1-01      AAPRRDALGLPGTPPGPPGPRREPVKLILPSISAMASGNDGDPPRAHGRR
                                             *: ::  *   ..  *  : :.* . *. 

U3ISP2_BOK-01           AE------------------------------------------------
A0A493TW00_BAK1-02      GSNGRRLSQELNSEDQVAQETEEVFRSYAFYRYQQEREESGEEVPLDPEI
A0A493TW00_BAK1-01      GSNGRRLSQELNSEDQVAQETEEVFRSYAFYRYQQEREESGEEVPLDPEI
                        ..                                                

U3ISP2_BOK-01           -------------VSTILLRLGDELEYIRPNVYRNIARQLNISLHSETVV
A0A493TW00_BAK1-02      AEIQQDLGSTGSLVGRRLAIIGDDINKRYDAEFRYMLKSLQLTKEN---A
A0A493TW00_BAK1-01      AEIQQDLGSTGSLVGRRLAIIGDDINKRYDAEFRYMLKSLQLTKEN---A
                                     *.  *  :**:::      :* : ..*:::  .   .

U3ISP2_BOK-01           TDAFLAVAAQIFTAGITWGKVVSLYAVAAGLAVDCVRHAQPAMVHTIVDC
A0A493TW00_BAK1-02      YDYFIKIASSLFESGINWGRVIALLGFGYCMAIHVYQHGITGFLRRIARY
A0A493TW00_BAK1-01      YDYFIKIASSLFESGINWGRVIALLGFGYCMAIHVYQHGITGFLRRIARY
                         * *: :*:.:* :**.**.*::* ...  :*:   .*. ..::. *.  

U3ISP2_BOK-01           LGEF-VRKTLVTWLKRRGGWADITKCVVNTDPSLRSHWLVAAVCSFGHFL
A0A493TW00_BAK1-02      VTEFMLRNRIAQWIAQQGGWVA---ALDLDNVYMKYMLAVVALVMVGHLV
A0A493TW00_BAK1-01      VTEFMLRNRIAQWIAQQGGWVA---ALDLDNVYMKYMLAVVALVMVGHLV
                        : ** :*: :. *: ..***.    .:   :  :.    *.*:  .**::

U3ISP2_BOK-01           KAIFFVLLPER-
A0A493TW00_BAK1-02      VRRFFRP-----
A0A493TW00_BAK1-01      VTIRLETVTGPV
                            :       

© 1998-2019