Dataset for protein Bok of organism Anabas testudineus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1I4R6_BOK-01      MEVLRRSSVFAAEVLDVFDRSLTEKELVSQSKALCRDYILSRLNQNGLGW
A0A3Q1I9F7_BOK-01      MEMLRRSSVFAAE---VFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGW
                       **:**********   ***** *:******:******** ****. *:**

A0A3Q1I4R6_BOK-01      SKTELNLSPSNAALADVSLVLLCLGDELECIQPSLWRNVARQLNISVAME
A0A3Q1I9F7_BOK-01      SKPEHGLAASGGALGEISSVLLWLGDELEYLRPNIYRNVARQLNIPVASE
                       **.* .*:.*..**.::* *** ****** :.*.::*********.** *

A0A3Q1I4R6_BOK-01      NMVSDAFIGVATEIFSTGITWGKVVSMYAVAGALAVDCVRQGHPSTVHII
A0A3Q1I9F7_BOK-01      GVVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAIVHTI
                       .:*****:.**::*****:*******:*************:***: ** *

A0A3Q1I4R6_BOK-01      VDSLGQFVRRFLVPWLKRRGGWAEISKCVVKKDLSPEHHWLSSVIESLKY
A0A3Q1I9F7_BOK-01      VDCMGEFVRKSLTSWLKKRGGWVDLTKCVVNTDPSFCSHWLVSAAFAFGY
                       **.:*:***. *..***.****.:::****:.* *   *** *.  :: *

A0A3Q1I4R6_BOK-01      FLTTMYVCIMKEP
A0A3Q1I9F7_BOK-01      YLKAIVLHLLREK
                       :*.:: : ::.* 

© 1998-2019