Dataset for protein BAX-like of organism Anabas testudineus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1I4R6_BOK-01      ---MEVLRRSSVFAAEVLDVFDRSLTEKELVSQSKALCRDYILSRLNQN-
A0A3Q1I9F7_BOK-01      ---MEMLRRSSVFAAE---VFDRSPTDKELVSQAKALCRDYIHSRLNRA-
R9Y0N7_BAX-01          -----------MASYPGG--GDQGNTKDQILEVGCVLLKDFIYERIQRHG
A0A3Q1I5B7_BAX-02      MADSREEEKKDGDEEPQGAVGGEGM---------------FVIERLSTD-
A0A3Q1I5B7_BAX-01      MADSREEEKKDGDEEPQGAVGGEDVVDDSIMEQAAVVLRGFVIERLSTD-
                                            . .                :: .*:.   

A0A3Q1I4R6_BOK-01      --GLGWSKTELN---LSPSNAALADVSLVLLCLGDELECIQPSLWRNVAR
A0A3Q1I9F7_BOK-01      --GIGWSKPEHG---LAASGGALGEISSVLLWLGDELEYLRPNIYRNVAR
R9Y0N7_BAX-01          DASTAVTRAQLGG--GELCDPNHKKLAQCLQQIGDELD-------ANVDL
A0A3Q1I5B7_BAX-02      DPGQQVSPEQLGGRPNEQQDPQIKDVVDQLIKIAEELN-------RNAEL
A0A3Q1I5B7_BAX-01      DPGQQVSPEQLGGRPNEQQDPQIKDVVDQLIKIAEELN-------RNAEL
                         .   :  : .       .    .:   *  :.:**:        *.  

A0A3Q1I4R6_BOK-01      QLNISVAMENMVSDAFIGVATEIFSTG-ITWGKVVSMYAVAGALAVDCVR
A0A3Q1I9F7_BOK-01      QLNIPVASEGVVSDAFLAVAADIFSTG-VTWGKVVSLYAVAGALAVDCVR
R9Y0N7_BAX-01          QRMINDSSLSPTKDIFMKVALEIFSDGKFNWGRVVALFYFACRLVIKAVV
A0A3Q1I5B7_BAX-02      QQLINQVQSNCAHDVFMTVVRSIFADG-INWGRVVALFHLAYRLIHRALT
A0A3Q1I5B7_BAX-01      QQLINQVQSNCAHDVFMTVVRSIFADG-INWGRVVALFHLAYRLIHRALT
                       *  *     . . * *: *. .**: * ..**.**::: .*  *   .: 

A0A3Q1I4R6_BOK-01      QGHPSTVHIIVDSLGQFVRRFLVPWLKRRGGWAEISKCVVKKDLSPEHHW
A0A3Q1I9F7_BOK-01      HGHPAIVHTIVDCMGEFVRKSLTSWLKKRGGWVDLTKCVVNTDPSFCSHW
R9Y0N7_BAX-01          TQVPDIIRTIISWTMDYLREHVINWIREQGGWEGIRSYF------GTPTW
A0A3Q1I5B7_BAX-02      TNHLDNIRMVFNWFLEVIRELLYSWLVQQGGWVGVIR--------GFSRW
A0A3Q1I5B7_BAX-01      TNHLDNIRMVFNWFLEVIRELLYSWLVQQGGWVGVIR--------GFSRW
                             :. :..   : :*  :  *:  .***  :              *

A0A3Q1I4R6_BOK-01      LSSVIESLKYFLTTMYVCIMKEP
A0A3Q1I9F7_BOK-01      LVSAAFAFGYYLKAIVLHLLREK
R9Y0N7_BAX-01          -QTVGVFLAGVLTTVLVIRKM--
A0A3Q1I5B7_BAX-02      -RTVAIAASVILVATFVYYRKTR
A0A3Q1I5B7_BAX-01      -RTVAIAASVILVATFVYYRKTR
                         :.       * :  :      

© 1998-2019