Dataset for protein BAX-like of organism Anabas testudineus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1I5B7_BAX-02      --------------MADSREEEKKDGDEEPQGAVGGEGM--FVIERLSTD
R9Y0N7_BAX-01          --------------MASYPGGGDQGNTKDQILEVGCVLLKDFIYERIQRH
A0A3Q1I5B7_BAX-01      MADSREEEKKDGDEEPQGA-VGGEDVVDDSIMEQAAVVLRGFVIERLSTD
A0A3Q1I4R6_BOK-01      ----MEVLRRSSVFAAEVLDVFDRSLTEKELVSQSKALCRDYILSRLNQN
A0A3Q1I9F7_BOK-01      ----MEMLRRSSVFAAE---VFDRSPTDKELVSQAKALCRDYIHSRLNRA
                                      ..       .  ..     .      :: .*:.  

A0A3Q1I5B7_BAX-02      -DPGQQVSPEQLGGRPNEQQDPQIKDVV----DQLIKIAEELNRNAELQQ
R9Y0N7_BAX-01          GDASTAVTRAQLGG--GELCDPNHKKLA----QCLQQIGDELDANVDLQR
A0A3Q1I5B7_BAX-01      -DPGQQVSPEQLGGRPNEQQDPQIKDVV----DQLIKIAEELNRNAELQQ
A0A3Q1I4R6_BOK-01      -GLG--WSKTELNLSPSNAALADVSLVLLCLGDELECIQPSLWRNVARQL
A0A3Q1I9F7_BOK-01      -GIG--WSKPEHGLAASGGALGEISSVLLWLGDELEYLRPNIYRNVARQL
                        . .   :  : .   .     : . :     : *  :  .:  *.  * 

A0A3Q1I5B7_BAX-02      LINQVQSNCAHDVFMTVVRSIFADG-INWGRVVALFHLAYRLIHRALTTN
R9Y0N7_BAX-01          MINDSSLSPTKDIFMKVALEIFSDGKFNWGRVVALFYFACRLVIKAVVTQ
A0A3Q1I5B7_BAX-01      LINQVQSNCAHDVFMTVVRSIFADG-INWGRVVALFHLAYRLIHRALTTN
A0A3Q1I4R6_BOK-01      NISVAMENMVSDAFIGVATEIFSTG-ITWGKVVSMYAVAGALAVDCVRQG
A0A3Q1I9F7_BOK-01      NIPVASEGVVSDAFLAVAADIFSTG-VTWGKVVSLYAVAGALAVDCVRHG
                        *     . . * *: *. .**: * ..**.**::: .*  *   .:   

A0A3Q1I5B7_BAX-02      HLDNIRMVFNWFLEVIRELLYSWLVQQGGWVGVIR--------GFSRW-R
R9Y0N7_BAX-01          VPDIIRTIISWTMDYLREHVINWIREQGGWEGIRSYF------GTPTW-Q
A0A3Q1I5B7_BAX-01      HLDNIRMVFNWFLEVIRELLYSWLVQQGGWVGVIRGF--------SRW-R
A0A3Q1I4R6_BOK-01      HPSTVHIIVDSLGQFVRRFLVPWLKRRGGWAEISKCVVKKDLSPEHHWLS
A0A3Q1I9F7_BOK-01      HPAIVHTIVDCMGEFVRKSLTSWLKKRGGWVDLTKCVVNTDPSFCSHWLV
                           :. :..   : :*  :  *:  .***  :              *  

A0A3Q1I5B7_BAX-02      TVAIAASVILVATFVYYRKTR
R9Y0N7_BAX-01          TVGVFLAGVLTTVLVIRKM--
A0A3Q1I5B7_BAX-01      TVAIAASVILVATFVYYRKTR
A0A3Q1I4R6_BOK-01      SVIESLKYFLTTMYVCIMKEP
A0A3Q1I9F7_BOK-01      SAAFAFGYYLKAIVLHLLREK
                       :.       * :  :      

© 1998-2019