Dataset for protein Bok of organism Amphiprion percula

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8SEB1_BOK-01      MEVLRRSSVFAAEVLDVFDRSLTEKELVSQSKALCRDYILSRLNQNGLGW
A0A3P8RKE4_BOK-02      MEMLRRSSVFAAE---VFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGW
A0A3P8RKE4_BOK-01      MEMLRRSSVFAAE---VFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGW
                       **:**********   ***** *:******:******** ****. *:**

A0A3P8SEB1_BOK-01      SKTEINFGPSNAALAEVSLVLLCLGDELECIQPSLYRNVARQLNISVAME
A0A3P8RKE4_BOK-02      SKPEHGLAASGGTLGEVSGVLLWLGDELEYLRPNVYRNVARQLNITVASE
A0A3P8RKE4_BOK-01      SKPEHGLAASGGTLGEVSGVLLWLGDELEYLRPNVYRNVARQLNITVASE
                       **.* .:..*..:*.*** *** ****** :.*.:**********:** *

A0A3P8SEB1_BOK-01      NMVSDAFIGVATEIFSAGITWGKVVSMYAVAGALAVDCVRQGHPTTVHIL
A0A3P8RKE4_BOK-02      SIVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTI
A0A3P8RKE4_BOK-01      SIVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTI
                       .:*****:.**::***:*:*******:*************:***: ** :

A0A3P8SEB1_BOK-01      VDSLGQFVRKFLVPWLKRRGGWAEITKCVVKKDLTPEQNWFSSTVESLTY
A0A3P8RKE4_BOK-02      VDCMGEFVRKSLTSWLKRRGGWLYKRKTTISSP--------MQTGLGYAQ
A0A3P8RKE4_BOK-01      VDCMGEFVRKSLTSWLKRRGGWADMTKCVVNTDPSFRSHWLVSAVCAFGH
                       **.:*:**** *..********    * .:..          .:  .   

A0A3P8SEB1_BOK-01      FLTTMYVYIMKEP------
A0A3P8RKE4_BOK-02      LSREICQETLQTSQALHGV
A0A3P8RKE4_BOK-01      YLKAVVLYLLREK------
                           :    :.        

© 1998-2019