Dataset for protein BAX-like of organism Amphiprion percula

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8TFP0_BAX-01      -------------MASHPGGGDQGNGKEQLVEVGAALLKDFIFERVQRHG
A0A3P8RS99_BAX-01      MSDSRDEEKSPGEQEPQGAVGGEDVVDDPILEQGAVVLRGYVIERINTED
A0A3P8SEB1_BOK-01      MEVLRRSSVFAAEVL---DVFDRSLTEKELVSQSKALCRDYILSRLNQNG
A0A3P8RKE4_BOK-02      MEMLRRSSVFAAE------VFDRSPTDKELVSQAKALCRDYIHSRLNRAG
A0A3P8RKE4_BOK-01      MEMLRRSSVFAAE------VFDRSPTDKELVSQAKALCRDYIHSRLNRAG
                                            . .  .. ::. . .: ..:: .*::  .

A0A3P8TFP0_BAX-01      DGKTVVTRAQLG-GGELVDPSHKKLGQCLQQIGDELD-------GNVELQ
A0A3P8RS99_BAX-01      PSRHVSSEDLGGRPDELQDPQIKEVVDQLLKIADELN-------RNAELQ
A0A3P8SEB1_BOK-01      LGWSKTEINFGP-----SNAALAEVSLVLLCLGDELECIQPSLYRNVARQ
A0A3P8RKE4_BOK-02      IGWSKPEHGLAA-----SGGTLGEVSGVLLWLGDELEYLRPNVYRNVARQ
A0A3P8RKE4_BOK-01      IGWSKPEHGLAA-----SGGTLGEVSGVLLWLGDELEYLRPNVYRNVARQ
                        ..               .    ::   *  :.***:        *.  *

A0A3P8TFP0_BAX-01      RMINDSSLSPTKDVFLKVAVEIFSDGKFNWGRVVALFYFACRLVIKALVT
A0A3P8RS99_BAX-01      RLINQVQGNCAQDIFMKVARSIFADG-INWGRVVALFHLAYRLIYKALTT
A0A3P8SEB1_BOK-01      LNISVAMENMVSDAFIGVATEIFSAG-ITWGKVVSMYAVAGALAVDCVRQ
A0A3P8RKE4_BOK-02      LNITVASESIVSDAFLAVAADIFSTG-VTWGKVVSLYAVAGALAVDCVRH
A0A3P8RKE4_BOK-01      LNITVASESIVSDAFLAVAADIFSTG-VTWGKVVSLYAVAGALAVDCVRH
                         *.    . ..* *: ** .**: * ..**.**::: .*  *  ..:  

A0A3P8TFP0_BAX-01      QVPDIIRTIIHWTMDYLREHVINWIREQGGWEGIR-----------SHFG
A0A3P8RS99_BAX-01      NHLENIRMVISWVLQVIREQLYAWLVQQGGWEGVIRSF--------SRWR
A0A3P8SEB1_BOK-01      GHPTTVHILVDSLGQFVRKFLVPWLKRRGGWAEITKCVVKKDLTPEQNWF
A0A3P8RKE4_BOK-02      GHPAMVHTIVDCMGEFVRKSLTSWLKRRGGWLYKRKTTISSP--------
A0A3P8RKE4_BOK-01      GHPAMVHTIVDCMGEFVRKSLTSWLKRRGGWADMTKCVVNTDPSFRSHWL
                            :. ::    : :*: :  *:  .***                   

A0A3P8TFP0_BAX-01      TPTWQTVGVFLAGVLTTVLVIRKM----
A0A3P8RS99_BAX-01      AAAIVA-SVVLVATFVYLRRTR------
A0A3P8SEB1_BOK-01      SSTVESLTYFLTTMYVYIMKEP------
A0A3P8RKE4_BOK-02      MQTGLGYAQLSREICQETLQTSQALHGV
A0A3P8RKE4_BOK-01      VSAVCAFGHYLKAVVLYLLREK------
                         :                         

© 1998-2019