Dataset for protein Bax of organism Amphiprion percula

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8RS99_BAX-01      MSDSRDEEKSPGEQEPQGAVGGEDVVDDPILEQGAVVLRGYVIERINTED
A0A3P8TFP0_BAX-01      ------MASHPGG-------GDQGNGKEQLVEVGAALLKDFIFERVQRHG
                               . **        *.:.  .: ::* **.:*..:::**::  .

A0A3P8RS99_BAX-01      PSRH-VSSEDLGGRPDELQDPQIKEVVDQLLKIADELNRNAELQRLINQV
A0A3P8TFP0_BAX-01      DGKTVVTRAQLGG--GELVDPSHKKLGQCLQQIGDELDGNVELQRMINDS
                        ..  *:  :***  .** **. *:: : * :*.***: *.****:**: 

A0A3P8RS99_BAX-01      QGNCAQDIFMKVARSIFADG-INWGRVVALFHLAYRLIYKALTTNHLENI
A0A3P8TFP0_BAX-01      SLSPTKDVFLKVAVEIFSDGKFNWGRVVALFYFACRLVIKALVTQVPDII
                       . . ::*:*:*** .**:** :*********::* **: ***.*:  : *

A0A3P8RS99_BAX-01      RMVISWVLQVIREQLYAWLVQQGGWEGVIRSF--SRWRAAAIVASVVLVA
A0A3P8TFP0_BAX-01      RTIIHWTMDYLREHVINWIREQGGWEGIRSHFGTPTWQTVGVFLAGVLTT
                       * :* *.:: :**::  *: :******:   *  . *.:..:. : **.:

A0A3P8RS99_BAX-01      TFVYLRRTR
A0A3P8TFP0_BAX-01      VLVIRKM--
                       .:*  .   

© 1998-2019