Dataset for protein Bok of organism Amphiprion ocellaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1ANM8_BOK-01      MEMLRRSSVFAAE---VFDRSPTDKELVSQAKALCRDYIHSRLNRTGIGW
A0A3Q1AZQ5_BOK-01      MEVLRRSSVFAAEVLDVFDRSLTEKELVSQSKALCRDYILSRLNQNGLGW
                       **:**********   ***** *:******:******** ****..*:**

A0A3Q1ANM8_BOK-01      SKPEHGLAASGGTLGEVSGVLLWLGDELEYLRPNVYRNVARQLNITVASE
A0A3Q1AZQ5_BOK-01      SKTEINFGPSNAALAEVSLVLLCLGDELECIQPSLYRNVARQLNISVAME
                       **.* .:..*..:*.*** *** ****** :.*.:**********:** *

A0A3Q1ANM8_BOK-01      SIVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTI
A0A3Q1AZQ5_BOK-01      NMVSDAFIGVATEIFSAGITWGKVVSMYAVAGALAVDCVRQGHPTTVHIL
                       .:*****:.**::***:*:*******:*************:***: ** :

A0A3Q1ANM8_BOK-01      VDCMGEFVRKSLTSWLKRRGGWADMTKCVVNTDPSFRSHWLVSAVFAFGH
A0A3Q1AZQ5_BOK-01      VDSLGQFVRKFLVPWLKRRGGWAEITKCVVKKDLTPEQNWFSSTVESLTY
                       **.:*:**** *..*********::*****:.* :  .:*: *:* :: :

A0A3Q1ANM8_BOK-01      YLKAVVLYLLREK
A0A3Q1AZQ5_BOK-01      FLTTMYVYIMKEP
                       :*.:: :*::.* 

© 1998-2019