Dataset for protein BAX-like of organism Amphiprion ocellaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1ANM8_BOK-01      ---MEMLRRSSVFAAE---VFDRSPTDKELVSQAKALCRDYIHSRLNRTG
A0A3Q1AZQ5_BOK-01      ---MEVLRRSSVFAAEVLDVFDRSLTEKELVSQSKALCRDYILSRLNQNG
A0A3Q1CKY3_BAX-01      -----------MASHPGGGDQGNG--KEQLVEVGAALLKDFIFERVQRHG
A0A3Q1CTC5_BAX-01      MSDSRDEEKSPGEQEPQGAVGGEDVIDDPILEQGAVVLRGYVIERINTED
                                            . .  .. ::. . .: ..:: .*::  .

A0A3Q1ANM8_BOK-01      IGWS-KPEHGLAASGGTLGEVSGVLLWLGDELEYLRPNVYRNVARQLNIT
A0A3Q1AZQ5_BOK-01      LGWS-KTEINFGPSNAALAEVSLVLLCLGDELECIQPSLYRNVARQLNIS
A0A3Q1CKY3_BAX-01      DSKTVVTRAQLGG--GELVDPS--HKKLGQCLQQIGDELDGNVELQRMIN
A0A3Q1CTC5_BAX-01      PSRH-VSSEDLGGRPDELQDPQ--IKEVVDQLLKIADELNRNAELQRLIN
                        ..   .   :.     * : .     : : *  :  .:  *.  *  *.

A0A3Q1ANM8_BOK-01      VASESIVSDAFLAVAADIFSTG-VTWGKVVSLYAVAGALAVDCVRHGHPA
A0A3Q1AZQ5_BOK-01      VAMENMVSDAFIGVATEIFSAG-ITWGKVVSMYAVAGALAVDCVRQGHPT
A0A3Q1CKY3_BAX-01      DSSLSPTKGVFLKVAVEIFSDGKFNWGRVVALFYFACRLVIKALVTQVPD
A0A3Q1CTC5_BAX-01      QVQGNCAQDIFMKVARSIFADG-INWGRVVALFHLAYRLIYKALTTNHLE
                           . ... *: ** .**: * ..**.**::: .*  *  ..:      

A0A3Q1ANM8_BOK-01      MVHTIVDCMGEFVRKSLTSWLKRRGGWADMTKCVVNTDPSFRSHWLVSAV
A0A3Q1AZQ5_BOK-01      TVHILVDSLGQFVRKFLVPWLKRRGGWAEITKCVVKKDLTPEQNWFSSTV
A0A3Q1CKY3_BAX-01      IIRTIIHWTMDYLREHVINWIREQGGWEGIRSHFGT------PTWQTVGV
A0A3Q1CTC5_BAX-01      NIRMVISWVLQVIREQLYAWLVQQGGWEGVIRSF--------SRWRTAAI
                        :. ::    : :*: :  *:  .***  :   .          *    :

A0A3Q1ANM8_BOK-01      FAFGHYLKAVVLYLLREK
A0A3Q1AZQ5_BOK-01      ESLTYFLTTMYVYIMKEP
A0A3Q1CKY3_BAX-01      F-LAGVLTTVLVIRKM--
A0A3Q1CTC5_BAX-01      V-ASVVLVATFVYLRRTR
                             * :  :      

© 1998-2019