Dataset for protein Bok of organism Amphilophus citrinellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q0RFY4_BOK-01      MEMLRRSSVFASE---VFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGW
A0A3Q0S613_BOK-01      MEVLRKSSVFASEVLDVFDRSLTEKELVSQSKALCRDYILSRLTQNGLGW
                       **:**.*******   ***** *:******:******** ***.. *:**

A0A3Q0RFY4_BOK-01      SKPEHGLSASGGTLGEISSVLLWLGDELECLRPNVYRNVARQLNITVASE
A0A3Q0S613_BOK-01      SKTELNFSPSNAALAEVSMVLLCLGDELECIQPTLYRNVARQLNISVAME
                       **.* .:*.*..:*.*:* *** *******:.*.:**********:** *

A0A3Q0RFY4_BOK-01      GVVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTI
A0A3Q0S613_BOK-01      NMVSDAFIGVATEIFSAGITWGKVVSMYAVAGALAVDCVRQGHPATVHIL
                       .:*****:.**::***:*:*******:*************:**** ** :

A0A3Q0RFY4_BOK-01      VDCMGEFVRKSLTAWLKRRGGWVDVTKCVVNTDPSFHSHWLVSAVCAFGH
A0A3Q0S613_BOK-01      VDSLGQFVRKFLVPWLKRRGGWVSITKCVVKKDLAPEENWLSSTFESLKY
                       **.:*:**** *..*********.:*****:.* :  .:** *:. :: :

A0A3Q0RFY4_BOK-01      YLKAVVLHLLREK
A0A3Q0S613_BOK-01      FLTTLYVYIMKEP
                       :*.:: ::::.* 

© 1998-2019