Dataset for protein BAX-like of organism Amphilophus citrinellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q0S1T8_BAX-01      ----------------------------------------EVGTILLKDF
A0A3Q0R008_BAX-01      MYSIIASVLCSRNHCIRALENLRSE----------DADMLTFLHCIHHMY
A0A3Q0RFY4_BOK-01      ------------MEMLRRSSVFASE---VFDRSPTDKELVSQAKALCRDY
A0A3Q0S613_BOK-01      ------------MEVLRKSSVFASEVLDVFDRSLTEKELVSQSKALCRDY
                                                                    : . :

A0A3Q0S1T8_BAX-01      IYERVRRHGDSNTVVTREQLGGTQLTDQNHKRLAQCLQQIGDELDG----
A0A3Q0R008_BAX-01      VITRINTEDPSRHVTSEDL--GGRPDEQQDPQIKEVV----DQLRKIADE
A0A3Q0RFY4_BOK-01      IHSRLNRAGIGW--SKPEH--GLSASGGTLGEISSVLLWLGDELECLRPN
A0A3Q0S613_BOK-01      ILSRLTQNGLGW--SKTEL--NFSPSNAALAEVSMVLLCLGDELECIQPT
                       :  *:   . ..   . :   .          :   :    *:*      

A0A3Q0S1T8_BAX-01      ---NVELQRMIDDSSLSPTKDIFLKVAIEIFSDGKFNWGRVVALFYFACR
A0A3Q0R008_BAX-01      LNRNAELQGLINQVQGNCAQDIFMAVARNIFADG-INWGRIVALFHLAYR
A0A3Q0RFY4_BOK-01      VYRNVARQLNITVASEGVVSDAFLAVAADIFSTG-VTWGKVVSLYAVAGA
A0A3Q0S613_BOK-01      LYRNVARQLNISVAMENMVSDAFIGVATEIFSAG-ITWGKVVSMYAVAGA
                          *.  *  *     . ..* *: ** :**: * ..**.:*::: .*  

A0A3Q0S1T8_BAX-01      LVIKALVTQIPDIIRTIIVWTMDYLREHVINWIREQGGWEGIRSYFGT--
A0A3Q0R008_BAX-01      LIYKALTTNHLENIRMVISWVLQVIREQLHTWLVQQGGWEGVIGSF----
A0A3Q0RFY4_BOK-01      LAVDCVRHGHPAMVHTIVDCMGEFVRKSLTAWLKRRGGWVDVTKCVVNTD
A0A3Q0S613_BOK-01      LAVDCVRQGHPATVHILVDSLGQFVRKFLVPWLKRRGGWVSITKCVVKKD
                       *  ..:       :. ::    : :*: :  *:  .*** .:   .    

A0A3Q0S1T8_BAX-01      ----PTWQTVGVFLAGVLTTVLVIRKM---
A0A3Q0R008_BAX-01      ----SRWRTVAIVA-SVALVVAFVYYRKVR
A0A3Q0RFY4_BOK-01      PSFHSHWLVSAVCAFGHYLKAVVLHLLREK
A0A3Q0S613_BOK-01      LAPEENWLSSTFESLKYFLTTLYVYIMKEP
                             *    .        .  :      

© 1998-2019