Dataset for protein Bax of organism Amphilophus citrinellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q0R008_BAX-01      MYSIIASVLCSRNHCIRALENLRSEDADMLTFLHCIHHMYVITRINTE-D
A0A3Q0S1T8_BAX-01      ------------------------------EVGTILLKDFIYERVRRHGD
                                                      .   : : ::  *:.   *

A0A3Q0R008_BAX-01      PSRHVTSEDLGGRPDEQQDPQIKEVVDQLRKIADELNRNAELQGLINQVQ
A0A3Q0S1T8_BAX-01      SNTVVTREQLGG--TQLTDQNHKRLAQCLQQIGDELDGNVELQRMIDDSS
                       ..  ** *:***   :  * : * :.: *.:*.***: *.*** :*:: .

A0A3Q0R008_BAX-01      GNCAQDIFMAVARNIFADG-INWGRIVALFHLAYRLIYKALTTNHLENIR
A0A3Q0S1T8_BAX-01      LSPTKDIFLKVAIEIFSDGKFNWGRVVALFYFACRLVIKALVTQIPDIIR
                        . ::***: ** :**:** :****:****::* **: ***.*:  : **

A0A3Q0R008_BAX-01      MVISWVLQVIREQLHTWLVQQGGWEGVIGSF--SRWRTVAIVASVALVVA
A0A3Q0S1T8_BAX-01      TIIVWTMDYLREHVINWIREQGGWEGIRSYFGTPTWQTVGVFLAGVLTTV
                        :* *.:: :**:: .*: :******: . *  . *.**.:. : .*...

A0A3Q0R008_BAX-01      FVYYRKVR
A0A3Q0S1T8_BAX-01      LVIRKM--
                       :*  .   

© 1998-2019