Dataset for protein BAX-like of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1L3H7_BAK1-01      MASGQGPGPPRQECGETAPSSTSASEEQVARDTEEVFRSYVFYRHRQEQEAEGAAAPADP
G1M7S3_BAX-01       -----------------TRREAEQPRGRGPTSSEQIMKTGALLLQGFIQDRAGRMGGETP
G1MDG6_BOK-01       ---------------------------------MEVLRRSSVFAAE-IMDAFDRSPTDKE
                                                      :::.   .       :  .       

G1L3H7_BAK1-01      EMVSLSLEPSSTMGQVGR---QLAIIGDDINQRYDSEFQTMLQHLQPTAENA---YEYFT
G1M7S3_BAX-01       ELALEQVPQDASTKKLSE---CLKRIGDELD-------SNMELQRMIAAVDTDSPREVFF
G1MDG6_BOK-01       LVAQAKAPAPVPGGRLAEVCAVLLRLGDELELIRPSVYRNVARQLNISLQSETVVTDAFL
                     :.  .     .  .:.     *  :**:::        .:  :   :  .     : * 

G1L3H7_BAK1-01      KIASSCSLFE-SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIAR
G1M7S3_BAX-01       RVAA--DMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDF-LRERLLG
G1MDG6_BOK-01       AVAS--QIFS-GGITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEF-VRKTLAP
                     :*:  .:*. ..:.**.**:*  ..  *.:       . ::  :     :* :.  :  

G1L3H7_BAK1-01      WIAQRGGWQVAALNLGN--GPILNVLIVLSLVLLGQFVVRRFFKS----
G1M7S3_BAX-01       WIQDQGGWDGLLSYFGT------PTWQTVTIFVAG-VLTASLTIWKKMG
G1MDG6_BOK-01       WLRRRGGWTDVLKCVVSTEPGFRSHWLVAALCSFGRFLKAAFFVLLPER
                    *:  .***      . .          . ::   * .:   :       

© 1998-2019