Dataset for protein BAX-like of organism Acanthochromis polyacanthus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1FXV2_BAX-01      -------------MASHPGGGDQGNGKEQLVEVGAALLKDFIFERVQRHG
A0A3Q1FSZ4_BAX-02      MSGSRDEDKPPGEQEPQGAVGGEDVVDDPILEQGAVVLRGYVIERINTED
A0A3Q1FSZ4_BAX-01      MSGSRDEDKPPGEQEPQGAVGGEDVVDDPILEQGAVVLRGYVIERINTED
A0A3Q1F1K1_BOK-01      MEMLRRSSVFAAE------VFDRSPTDKELVSQAKALCRDYIHSRLNRAG
A0A3Q1FIY9_BOK-01      MEVLRRSSVFAAEVL---DVFDRSLTEKELVSQSKALCRDYILSRLNQNG
                                            . .  .. ::. . .: ..:: .*::  .

A0A3Q1FXV2_BAX-01      DGNTVVTRAQLG-GGELVDPNHKKLG--QCLQQIGDELDGNVELQRMIND
A0A3Q1FSZ4_BAX-02      PSRHVSSEDLGGRPDELQDPQIKEVV--DQLLKIADDLNRNAELQRLINQ
A0A3Q1FSZ4_BAX-01      PSRHVSSEDLGGRPDELQDPQIKEVV--DQLLKIADDLNRNAELQRLINQ
A0A3Q1F1K1_BOK-01      IGWSKPEHGLAASGGTLGEVSSVLLWLGDELEYLRPNVYRNVARQLNITV
A0A3Q1FIY9_BOK-01      LGWSKTEINFGPSNAALAEVSLVLLCLGDELECIQPSLYRNVARQLNISV
                        ..             * : .   :   : *  :  .:  *.  *  *. 

A0A3Q1FXV2_BAX-01      SSLSPTKDVFMKVAVEIFSDGKFNWGRVVALFYFACRLVIKALVTQVPDI
A0A3Q1FSZ4_BAX-02      VQGNCAQDIFMKVARSIFADG-INWGRVVALFHLAYRLIYKALTTNHLEN
A0A3Q1FSZ4_BAX-01      VQGNCAQDIFMKVARSIFADG-INWGRVVALFHLAYRLIYKALTTNHLEN
A0A3Q1F1K1_BOK-01      ASESIVSDAFLAVAADIFSTG-VTWGKVVSLYAVAGALAVDCVRHGHPAM
A0A3Q1FIY9_BOK-01      AMENMVSDAFIGVATEIFSAG-ITWGKVVSMYAVAGALAVDCVRQGHPTT
                          . ..* *: ** .**: * ..**.**::: .*  *  ..:       

A0A3Q1FXV2_BAX-01      IRTIIHWTMDYLREHVINWIREQGGWEG-----------IRSHFGTPTWQ
A0A3Q1FSZ4_BAX-02      IRMIISWVLQFIREQLYVWLVQQGGWEG-----------VIRSF--SRWR
A0A3Q1FSZ4_BAX-01      IRMIISWVLQFIREQLYVWLVQQGGWVSGTSSVKFCPVCLFKAFWSPAWT
A0A3Q1F1K1_BOK-01      VHTIVDCMGEFVRKSLTSWLKKRGGWADMTKCVVNTDPSFR-----SHWL
A0A3Q1FIY9_BOK-01      VHILVDSLGQFVRKFLVPWLKRRGGWVSITKCVVKKDLAPE-----QNWF
                       :. ::    :::*: :  *:  .*** .                    * 

A0A3Q1FXV2_BAX-01      TVGVFLAGVLTTVLVIRKM---
A0A3Q1FSZ4_BAX-02      TAAIVA-SVVLVATFIYLRRTR
A0A3Q1FSZ4_BAX-01      CSGIQS-S--------------
A0A3Q1F1K1_BOK-01      VSAVCAFGHYLKAVVLYLLREK
A0A3Q1FIY9_BOK-01      SSTVESLKYFLTTMYVYIMKEP
                          :                  

© 1998-2019