Dataset for protein Bax of organism Acanthochromis polyacanthus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1FXV2_BAX-01      -----MASHPGGGDQGNG--------KEQLVEVGAALLKDFIFERVQRHG
A0A3Q1FSZ4_BAX-02      MSGSRDEDKPPGEQEPQGAVGGEDVVDDPILEQGAVVLRGYVIERINTE-
A0A3Q1FSZ4_BAX-01      MSGSRDEDKPPGEQEPQGAVGGEDVVDDPILEQGAVVLRGYVIERINTE-
                              .:* * :: :*        .: ::* **.:*..:::**::   

A0A3Q1FXV2_BAX-01      DGNTVVTRAQLGG--GELVDPNHKKLGQCLQQIGDELDGNVELQRMINDS
A0A3Q1FSZ4_BAX-02      DPSRHVSSEDLGGRPDELQDPQIKEVVDQLLKIADDLNRNAELQRLINQV
A0A3Q1FSZ4_BAX-01      DPSRHVSSEDLGGRPDELQDPQIKEVVDQLLKIADDLNRNAELQRLINQV
                       * .  *:  :***  .** **: *:: : * :*.*:*: *.****:**: 

A0A3Q1FXV2_BAX-01      SLSPTKDVFMKVAVEIFSDGKFNWGRVVALFYFACRLVIKALVTQVPDII
A0A3Q1FSZ4_BAX-02      QGNCAQDIFMKVARSIFADG-INWGRVVALFHLAYRLIYKALTTNHLENI
A0A3Q1FSZ4_BAX-01      QGNCAQDIFMKVARSIFADG-INWGRVVALFHLAYRLIYKALTTNHLENI
                       . . ::*:***** .**:** :*********::* **: ***.*:  : *

A0A3Q1FXV2_BAX-01      RTIIHWTMDYLREHVINWIREQGGWEG-----------IRSHFGTPTWQT
A0A3Q1FSZ4_BAX-02      RMIISWVLQFIREQLYVWLVQQGGWEG-----------VIRSF--SRWRT
A0A3Q1FSZ4_BAX-01      RMIISWVLQFIREQLYVWLVQQGGWVSGTSSVKFCPVCLFKAFWSPAWTC
                       * ** *.::::**::  *: :**** .           :   *  . *  

A0A3Q1FXV2_BAX-01      VGVFLAGVLTTVLVIRKM--
A0A3Q1FSZ4_BAX-02      AAIVASVVLVATFIYLRRTR
A0A3Q1FSZ4_BAX-01      SGIQSS--------------
                        .:  :              

© 1998-2019