Dataset for protein Noxa of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

47 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      -------------------------LSKETFMAKGKVLFASMPHRSSNKN
A0A2I3HX97_PMAIP1-      -----------------------------------------KPGR-ARRN
A0A1D5PAR2_PMAIP1-      ----------------------------------------MMPGRTIRK-
A0A2K6EM90_PMAIP1-      -----------------------------------------MPVKKARKN
G1P8F9_PMAIP1-01        -----------------------------------------MPGKKARKN
G3T0P7_PMAIP1-01        -----------------------------------------MPGKKARKS
Q1PCT2_PMAIP1-01        -----------------------------------------MPGRKARKS
G1LIZ7_PMAIP1-01        -----------------------------------------MPGKKARKS
A0A2K5NJZ2_PMAIP1-      -----------------------------------------MPGKKARKN
A0A0D9S003_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2K5VPX2_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2K6BV75_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2K5ZWH1_PMAIP1-      -----------------------------------------MPGKKARKN
A0A096MPU8_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2K5JY52_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2K6KJF2_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2K6NC45_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2K6S6C4_PMAIP1-      -----------------------------------------MPGKKARKS
A0A2I2YVQ5_PMAIP1-      -----------------------------------------MPGKKARKN
Q13794_PMAIP1-01        -----------------------------------------MPGKKARKN
A0A2R9AKC9_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
H2NWG2_PMAIP1-01        -----------------------------------------MPGKKARKN
A0A2K5CFK7_PMAIP1-      -----------------------------------------MPGKKARKS
F7GW45_PMAIP1-01        -----------------------------------------MPGKKARKS
A0A337SUX1_PMAIP1-      -----------------------------------------MPGKRTRKS
W5P738_PMAIP1-01        -----------------------------------------MPGRRARRS
Q9GL49_PMAIP1-01        MRSSGSLGSRIRGLLESAGWEELVRSQPRAHQGLTSGRCGQTRREELRGS
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A2K5JY52_PMAIP1-      -----------------------------------------MPGKKARKN
A0A096MPU8_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2K5ZWH1_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2K5VPX2_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2K6BV75_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2K6KJF2_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2K6NC45_PMAIP1-      -----------------------------------------MPGKKARKN
Q13794_PMAIP1-02        -----------------------------------------MPGKKARKN
A0A2R9AKC9_PMAIP1-      -----------------------------------------MPGKKARKN
A0A1D5QGJ8_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2I2YVQ5_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
A0A286XF37_PMAIP1-      -----------------------------------------MPGKVCKSA
A0A1U7QLK6_PMAIP1-      -----------------------------------------MLQSVARQN
Q9JM54_PMAIP1-01        -----------------------------------------MPGRKARRN
Q5U777_PMAIP1-01        -----------------------------------------MPGRKARRN
                                                                          

A0A0P0HZF9_PMAIP1-      --------M-----------------------------------------
Q0GKC8_PMAIP1-01        --------M-----------------------------------------
A0A287AZR7_PMAIP1-      TQTNPLRLA-----------------------------------------
A0A2I3HX97_PMAIP1-      AQPSPAPAP-----------------------------------------
A0A1D5PAR2_PMAIP1-      --PAPPAAP-----------------------------------------
A0A2K6EM90_PMAIP1-      AQPSPTRTR-----------------------------------------
G1P8F9_PMAIP1-01        AQPSPTRAP-----------------------------------------
G3T0P7_PMAIP1-01        AQPGPAGTP-----------------------------------------
Q1PCT2_PMAIP1-01        AQPGPTRAP-----------------------------------------
G1LIZ7_PMAIP1-01        AQASPARTR-----------------------------------------
A0A2K5NJZ2_PMAIP1-      AQPSPMRAQ-----------------------------------------
A0A0D9S003_PMAIP1-      AQPSPTRAQ-----------------------------------------
A0A2K5VPX2_PMAIP1-      AQPSPTRAQ-----------------------------------------
A0A2K6BV75_PMAIP1-      AQPSPTRAQ-----------------------------------------
A0A2K5ZWH1_PMAIP1-      AQPSPTRAQ-----------------------------------------
A0A096MPU8_PMAIP1-      AQPSPTRAQ-----------------------------------------
A0A2K5JY52_PMAIP1-      AQPSPARAQ-----------------------------------------
A0A2K6KJF2_PMAIP1-      AQPSPARAQ-----------------------------------------
A0A2K6NC45_PMAIP1-      AQPSPARAQ-----------------------------------------
A0A2K6S6C4_PMAIP1-      AQPSPARAP-----------------------------------------
A0A2I2YVQ5_PMAIP1-      AQPSPARAP-----------------------------------------
Q13794_PMAIP1-01        AQPSPARAP-----------------------------------------
A0A2R9AKC9_PMAIP1-      AQPSPARAP-----------------------------------------
A0A2I3SX38_PMAIP1-      AQPSPARAP-----------------------------------------
H2NWG2_PMAIP1-01        AQPSPARAP-----------------------------------------
A0A2K5CFK7_PMAIP1-      AQPSPSRAP-----------------------------------------
F7GW45_PMAIP1-01        AQPSPARAP-----------------------------------------
A0A337SUX1_PMAIP1-      AQPSPARAP-----------------------------------------
W5P738_PMAIP1-01        AQPSPTRVP-----------------------------------------
Q9GL49_PMAIP1-01        FGPPPAAVR-GNQPTSEAFGRSGCCFSSSLPLARFCPTAPRAACYLQSQG
F1SMU1_PMAIP1-01        -----ARAA-AGAPTSEAFGRSGCCFSSSLPLARFCPTAPRAACYLQSQG
A0A2K5JY52_PMAIP1-      AQPSPARAQ-AGT-DPLGPAKTQAGRGRG------RGKKLL-----SSPL
A0A096MPU8_PMAIP1-      AQPSPTRAQ-AGQAGTAGTARDQAGFGIGMQLHFTRSKKLV----SSSPL
A0A2K5ZWH1_PMAIP1-      AQPSPTRAQ-AGQAGTAGTARDQAGFGIGMQLHFTRGKKLV----SSSPL
A0A2K5VPX2_PMAIP1-      AQPSPTRAQ-AGQAGTAGTARDQAGFGIGMQLHYTRGKKLV----SSSPL
A0A2K6BV75_PMAIP1-      AQPSPTRAQ-AGPAGTAGTARDQAGFGIGMQLHYTRGKKLV----SSSPL
A0A2K6KJF2_PMAIP1-      AQPSPARAQ-AGPAGTAGTARDQAGLGIGMQLHFTRGKKLL----SSSPL
A0A2K6NC45_PMAIP1-      AQPSPARAQ-AGPAGTAGTARDQAGLGIGMQLHFTRGKKLL----SSSPL
Q13794_PMAIP1-02        AQPSPARAP-AGPAGTAGTARDQAGFAIGMQLRFTRGKKLLSSSLSSSPL
A0A2R9AKC9_PMAIP1-      AQPSPARAP-AGP---AGTARDQAGFGIGMQLRFTRGKKLLSSS-SSSPL
A0A1D5QGJ8_PMAIP1-      AQPSPTRAQAAGTAGTAGTARDQAGFGIGMQLHYTRGKKLVSSS----PL
A0A2I2YVQ5_PMAIP1-      AQPSPARAP----AGPAGTARDQAGFGIEMQLRFTRGKKLLSSS----PL
A0A2I3SX38_PMAIP1-      AQPSPARAP----AGPAGTARDQAGFGIGMQLRFTRGKKLLSSSLSSWPL
A0A286XF37_PMAIP1-      QP-NSTRAE-----------------------------------------
A0A1U7QLK6_PMAIP1-      APSNPARAE-----------------------------------------
Q9JM54_PMAIP1-01        APVNPTRAE-----------------------------------------
Q5U777_PMAIP1-01        APLNPTRAE-----------------------------------------
                                                                          

A0A0P0HZF9_PMAIP1-      -------------------------------------------------A
Q0GKC8_PMAIP1-01        -------------------------------------------------A
A0A287AZR7_PMAIP1-      -------------------------------------------------L
A0A2I3HX97_PMAIP1-      -------------------------------------------------A
A0A1D5PAR2_PMAIP1-      -------------------------------------------------A
A0A2K6EM90_PMAIP1-      -------------------------------------------------A
G1P8F9_PMAIP1-01        -------------------------------------------------A
G3T0P7_PMAIP1-01        -------------------------------------------------A
Q1PCT2_PMAIP1-01        -------------------------------------------------E
G1LIZ7_PMAIP1-01        -------------------------------------------------G
A0A2K5NJZ2_PMAIP1-      -------------------------------------------------A
A0A0D9S003_PMAIP1-      -------------------------------------------------A
A0A2K5VPX2_PMAIP1-      -------------------------------------------------A
A0A2K6BV75_PMAIP1-      -------------------------------------------------A
A0A2K5ZWH1_PMAIP1-      -------------------------------------------------A
A0A096MPU8_PMAIP1-      -------------------------------------------------A
A0A2K5JY52_PMAIP1-      -------------------------------------------------A
A0A2K6KJF2_PMAIP1-      -------------------------------------------------A
A0A2K6NC45_PMAIP1-      -------------------------------------------------A
A0A2K6S6C4_PMAIP1-      -------------------------------------------------A
A0A2I2YVQ5_PMAIP1-      -------------------------------------------------A
Q13794_PMAIP1-01        -------------------------------------------------A
A0A2R9AKC9_PMAIP1-      -------------------------------------------------A
A0A2I3SX38_PMAIP1-      -------------------------------------------------A
H2NWG2_PMAIP1-01        -------------------------------------------------A
A0A2K5CFK7_PMAIP1-      -------------------------------------------------A
F7GW45_PMAIP1-01        -------------------------------------------------A
A0A337SUX1_PMAIP1-      -------------------------------------------------A
W5P738_PMAIP1-01        -------------------------------------------------A
Q9GL49_PMAIP1-01        ARVRGLSSRSFAAKFRLLFA--------EMPGRRSRRNTQTNPTRVALPP
F1SMU1_PMAIP1-01        ARVRGLSSRSFAAKFRLLFA--------EMPGRRSRRNTQTNPTRVALPP
A0A2K5JY52_PMAIP1-      ALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLLLRNLTAT
A0A096MPU8_PMAIP1-      ALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLLLRNLTAS
A0A2K5ZWH1_PMAIP1-      ALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLLLRNLTAS
A0A2K5VPX2_PMAIP1-      VLPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLLLRNLTAS
A0A2K6BV75_PMAIP1-      VLPRGHEEQVQVARSRVCYSTQEIWRQTKLPAETSESDSQTLLLRNLTAS
A0A2K6KJF2_PMAIP1-      ALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETFESDSQTLLLRNLTAS
A0A2K6NC45_PMAIP1-      ALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETFESDSQTLLLRNLTAS
Q13794_PMAIP1-02        ALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTAS
A0A2R9AKC9_PMAIP1-      ALPRGHEEQAQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTAS
A0A1D5QGJ8_PMAIP1-      VLPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLLLRNLTAS
A0A2I2YVQ5_PMAIP1-      ALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTAS
A0A2I3SX38_PMAIP1-      ALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTAS
A0A286XF37_PMAIP1-      -LEVECAAQLRRVGDTLNSLGCTTEALEVLAEMAGKKARKS---SEPDPA
A0A1U7QLK6_PMAIP1-      -LAPEFIAQLRRIGDKLSSEWCEPDIIAVLAEMPGKKARKSVT-RIPSPT
Q9JM54_PMAIP1-01        -LPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRM--RSPSPT
Q5U777_PMAIP1-01        -LPPEFAAQLRKIGDKVYCTWSAPDITAVLAQMPGKKSRKSTMRRSPSPT
                                                                          

A0A0P0HZF9_PMAIP1-      KKEKTAVVECAQQL------RTIGDLFDWKYKLLEIIIALQKAQTDGKR-
Q0GKC8_PMAIP1-01        KKEQTAVVECAQQL------RNIGDLLNWKYKLLELIVTLQKIQMEGKR-
A0A287AZR7_PMAIP1-      PPL--PAVKCRIGL------RRVGTKLAIRQQITNFIIFFFFLGP-----
A0A2I3HX97_PMAIP1-      ELE----VECATQL------RRFGDKLNFRQKLLNLISKLFCSGT-----
A0A1D5PAR2_PMAIP1-      ERD--AVAECALEL------RRIGDKADLQQKVLNLITKLFCPKT-----
A0A2K6EM90_PMAIP1-      EIE----EECALQL------RRLGDKLHFQQKLLNLIAKLFRSGT-----
G1P8F9_PMAIP1-01        EAE----IECALQL------RRIGDKLSFLQKLLNLMYKLFGSGT-----
G3T0P7_PMAIP1-01        GTQQRDVVECAIQL------RRIGDKINFRQKLLNVICKLFCSGT-----
Q1PCT2_PMAIP1-01        ELE----VECAIQL------RKFGDKLNFRQKLLNLLSKLFRSGT-----
G1LIZ7_PMAIP1-01        QPE----VECAIQL------RRFGDKLNFRQKLLNLISKLFRSGT-----
A0A2K5NJZ2_PMAIP1-      ELE----VECATQL------RRFGDKLNFRQKLLNLIAKLFCSGT-----
A0A0D9S003_PMAIP1-      ELE----VECATQL------RRFGDKLNFRQKLLNLIAKLFCSGT-----
A0A2K5VPX2_PMAIP1-      ELE----VECATQL------RRFGDKLNFRQKLLNLIAKLFCSGT-----
A0A2K6BV75_PMAIP1-      ELE----VECATQL------RRFGDKLNFRQKLLNLIAKLFCSGT-----
A0A2K5ZWH1_PMAIP1-      ELE----VECATQL------RRFGDKLNFRQKLLNLIAKLFCSGT-----
A0A096MPU8_PMAIP1-      ELE----VECATQL------RRFGDKLNFRQKLLNLIAKLFCSGT-----
A0A2K5JY52_PMAIP1-      ELE----VECATQL------RRFGDKLNFRQKLLNLIAKLFCSGT-----
A0A2K6KJF2_PMAIP1-      ELE----VECATQL------RRFGDKLNFRQKLLNLIAKLFCSGT-----
A0A2K6NC45_PMAIP1-      ELE----VECATQL------RRFGDKLNFRQKLLNLIAKLFCSGT-----
A0A2K6S6C4_PMAIP1-      DLE----VECAIQL------RRFGDKLNFRQKLLNLISKLFCSGT-----
A0A2I2YVQ5_PMAIP1-      ELE----VECATQL------RRFGDKLNFRQKLLNLISKLFCSGT-----
Q13794_PMAIP1-01        ELE----VECATQL------RRFGDKLNFRQKLLNLISKLFCSGT-----
A0A2R9AKC9_PMAIP1-      ELE----VECATQL------RRFGDKLNFRQKLLNLISKLFCSGT-----
A0A2I3SX38_PMAIP1-      ELE----VECATQL------RRFGDKLNFRQKLLNLISKLFCSGT-----
H2NWG2_PMAIP1-01        ELE----VECATQL------RRFGDKLNFRQKLLNLISKLFCSGT-----
A0A2K5CFK7_PMAIP1-      DLE----VECATQL------RRFGDKLNFRQKLLNLISKLFCSGT-----
F7GW45_PMAIP1-01        DLE----VECATQL------RRFGDKLNFRQKLLNLISKLFCSGT-----
A0A337SUX1_PMAIP1-      EPE----VECAMQL------RRFGDKLNFRQKLMNLISKLFRSGT-----
W5P738_PMAIP1-01        DPE----VECAIQL------RRIGDKLNFRQKLVNLIAKLLRSGT-----
Q9GL49_PMAIP1-01        D----------PEVECAIQFRRIGDKLNFRQKLLNLIAKLFRLGT-----
F1SMU1_PMAIP1-01        D----------PEVECAIQFRRIGDKLNFRQKLLNLIAKLFRLGT-----
A0A2K5JY52_PMAIP1-      K----------TCM------RGLQKRIFLRRCTFHQFEARLHCN------
A0A096MPU8_PMAIP1-      K----------TCI------GGLQKRLFLRRCTLHQFEERLHCNW-----
A0A2K5ZWH1_PMAIP1-      K----------TCI------RGLQKRLFLRRCILHKFEERLHCNW-----
A0A2K5VPX2_PMAIP1-      K----------TCI------RGLQKRLFLRRCTLHQFEERLHCNW-----
A0A2K6BV75_PMAIP1-      K----------TCI------RGLQKRLFLRRCTLHQFEERLHCNW-----
A0A2K6KJF2_PMAIP1-      K----------TCI------RGLQTRIFLRRCTFHQFEERLHCNW-----
A0A2K6NC45_PMAIP1-      K----------TCI------RGLQTRIFLRRCTFHQFEERLHCNW-----
Q13794_PMAIP1-02        K----------TCM------RGLLQKSFLRRCTFHQFEERLHCN------
A0A2R9AKC9_PMAIP1-      K----------TCM------RGLLQKSFLRRCTFHQFEERLHCNW-----
A0A1D5QGJ8_PMAIP1-      K----------TCI------RGLQKRLFLRRCTLHQFEERLHCN------
A0A2I2YVQ5_PMAIP1-      K----------TCM------RGLLQKSFLRRCTFHQFEERLHCNWEECEG
A0A2I3SX38_PMAIP1-      K----------TCM------RGLLQKSFLRRCTFHQFEERLHCNW-----
A0A286XF37_PMAIP1-      RARAELEVECAAQL------RRIGDKLNFQQKLMYLISKLISLVT-----
A0A1U7QLK6_PMAIP1-      RVPTDVEDECVHQL------RRIGDKQNLRQKLLNFISKLFSLVT-----
Q9JM54_PMAIP1-01        RVPADLKDEC-AQL------RRIGDKVNLRQKLLNLISKLFNLVT-----
Q5U777_PMAIP1-01        RVPADLKDEC-DQL------RRIGDKVNLRQKLLNFISKLFNLIT-----
                                     :        .             :             

A0A0P0HZF9_PMAIP1-      ---------------
Q0GKC8_PMAIP1-01        ---------------
A0A287AZR7_PMAIP1-      ---------------
A0A2I3HX97_PMAIP1-      ---------------
A0A1D5PAR2_PMAIP1-      ---------------
A0A2K6EM90_PMAIP1-      ---------------
G1P8F9_PMAIP1-01        ---------------
G3T0P7_PMAIP1-01        ---------------
Q1PCT2_PMAIP1-01        ---------------
G1LIZ7_PMAIP1-01        ---------------
A0A2K5NJZ2_PMAIP1-      ---------------
A0A0D9S003_PMAIP1-      ---------------
A0A2K5VPX2_PMAIP1-      ---------------
A0A2K6BV75_PMAIP1-      ---------------
A0A2K5ZWH1_PMAIP1-      ---------------
A0A096MPU8_PMAIP1-      ---------------
A0A2K5JY52_PMAIP1-      ---------------
A0A2K6KJF2_PMAIP1-      ---------------
A0A2K6NC45_PMAIP1-      ---------------
A0A2K6S6C4_PMAIP1-      ---------------
A0A2I2YVQ5_PMAIP1-      ---------------
Q13794_PMAIP1-01        ---------------
A0A2R9AKC9_PMAIP1-      ---------------
A0A2I3SX38_PMAIP1-      ---------------
H2NWG2_PMAIP1-01        ---------------
A0A2K5CFK7_PMAIP1-      ---------------
F7GW45_PMAIP1-01        ---------------
A0A337SUX1_PMAIP1-      ---------------
W5P738_PMAIP1-01        ---------------
Q9GL49_PMAIP1-01        ---------------
F1SMU1_PMAIP1-01        ---------------
A0A2K5JY52_PMAIP1-      ---------------
A0A096MPU8_PMAIP1-      ---------------
A0A2K5ZWH1_PMAIP1-      ---------------
A0A2K5VPX2_PMAIP1-      ---------------
A0A2K6BV75_PMAIP1-      ---------------
A0A2K6KJF2_PMAIP1-      ---------------
A0A2K6NC45_PMAIP1-      ---------------
Q13794_PMAIP1-02        ---------------
A0A2R9AKC9_PMAIP1-      ---------------
A0A1D5QGJ8_PMAIP1-      ---------------
A0A2I2YVQ5_PMAIP1-      AFMGALGNGRWNTSK
A0A2I3SX38_PMAIP1-      ---------------
A0A286XF37_PMAIP1-      ---------------
A0A1U7QLK6_PMAIP1-      ---------------
Q9JM54_PMAIP1-01        ---------------
Q5U777_PMAIP1-01        ---------------
                                       

© 1998-2018