Dataset for protein Hrk of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

24 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7G1G0_HRK-01          MCPCPLHRGRGPPAVCACSSDRLEQRAAAAAQLTAARLKALGDELQERTM
A0A1U7R468_HRK-01      MCPCPRHRGHGPPAVCGCGDTRPGLR-WAAAQVTALRLQALGDELHRRAM
P62816_HRK-03          MCPCPRHRGRGPPAVCGCGDARPGLR-WAAAQVTALRLQALGDELHRRAM
P62817_HRK-01          MCPCPRHRGRGPPAVCGCGDARPGLR-WAAAQVTALRLQALGDELHRRAM
A0A287A5N9_HRK-01      MCPCPLHRGRGPPAVCACSASRLGLR-SSAAQLTAARLKALGDELHQRTM
H2NIS8_HRK-01          MCPCPLHRDRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
A0A2K5KZ69_HRK-01      MCPCPLHRGRGPPAVCDCSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
H2Q6Y8_HRK-01          MCPCPLHRGRDPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
G3UH24_HRK-01          MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
A0A2K5BYA0_HRK-01      MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
G3MWR6_HRK-01          MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
U3E722_HRK-01          MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
A0A0D9SC73_HRK-01      MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
A0A337SQ56_HRK-01      MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
G3QTJ6_HRK-01          MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
O00198_HRK-01          MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
A0A1D5R1E4_HRK-01      MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
A0A2K6AYL7_HRK-01      MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
G1QHD8_HRK-01          MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
G1T7W1_HRK-01          MCPCPLHRGRGPPAVCACSAGRLGLR-SAAAQLTAARLKALGDELHQRTM
H0Y001_HRK-01          MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
A0A096N944_HRK-01      MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
A0A2K6GL98_HRK-01      MCPCPLHRGRGPPAVCACSAGRLGLR-SSAAQLTAARLKALGDELHQRTM
E2RLD4_HRK-01          MCPCPLHRGRGPPAVCACSAGRLALR-SSAAQLTAARLKALGDELHQRTM
                       ***** **...***** *.  *   *  :***:** **:******: *:*

F7G1G0_HRK-01          WRRRARSRRAAAEAAGSGGGGLPAY---WAWLCAAAHVAALAAWLLRRRN
A0A1U7R468_HRK-01      -RRRARP-RDPLP------ALLPALRARWPWLCAAAQVAALAAWLLGRRS
P62816_HRK-03          -RRRARP-RDPLP------ALLPALRARWPWLCAAAQVAALAAWLLGRRS
P62817_HRK-01          -RRRARP-RDPLP------ALLPALRARWPWLCAAAQVAALAAWLLGRRS
A0A287A5N9_HRK-01      WRRSARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLGRRN
H2NIS8_HRK-01          WRRRARSRRAPAP------SALPTY---WPWLCAAAQVAALAAWLLGRRN
A0A2K5KZ69_HRK-01      WRRRARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLSRRN
H2Q6Y8_HRK-01          WRRRARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLGRRN
G3UH24_HRK-01          WRRRARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLRRRN
A0A2K5BYA0_HRK-01      WRRRARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLGRRN
G3MWR6_HRK-01          WRRRARSRRAPAS------GALPTY---WPWLCAAAQVAALAAWLLGRRN
U3E722_HRK-01          WRRRARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLGRRN
A0A0D9SC73_HRK-01      WRRRARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLGRRN
A0A337SQ56_HRK-01      WRRRARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLGRRN
G3QTJ6_HRK-01          WRRRARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLGRRN
O00198_HRK-01          WRRRARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLGRRN
A0A1D5R1E4_HRK-01      WRRRARSRRAPAS------GALPTY---WPWLCAAAQVAALAAWLLGRRN
A0A2K6AYL7_HRK-01      WRRRARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLGRRN
G1QHD8_HRK-01          WRRRARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLGRRN
G1T7W1_HRK-01          WRRRARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLGRRN
H0Y001_HRK-01          WRRRARSRRAPAP------GALTTY---WPWLCAAAQVAALAAWLLGRRN
A0A096N944_HRK-01      WRRRARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWLLGRRN
A0A2K6GL98_HRK-01      WRRRARSRRAPAP------GALTTY---WPWLCAAAQVAALAAWLLGRRN
E2RLD4_HRK-01          WRRRARSRRAPAP------RALPTY---WPWLCAAAQVAALAAWLLGRRN
                        ** **. * .          *.:    *.******:********* **.

F7G1G0_HRK-01          L
A0A1U7R468_HRK-01      A
P62816_HRK-03          A
P62817_HRK-01          A
A0A287A5N9_HRK-01      L
H2NIS8_HRK-01          L
A0A2K5KZ69_HRK-01      L
H2Q6Y8_HRK-01          L
G3UH24_HRK-01          L
A0A2K5BYA0_HRK-01      L
G3MWR6_HRK-01          L
U3E722_HRK-01          L
A0A0D9SC73_HRK-01      L
A0A337SQ56_HRK-01      L
G3QTJ6_HRK-01          L
O00198_HRK-01          L
A0A1D5R1E4_HRK-01      L
A0A2K6AYL7_HRK-01      L
G1QHD8_HRK-01          L
G1T7W1_HRK-01          L
H0Y001_HRK-01          L
A0A096N944_HRK-01      L
A0A2K6GL98_HRK-01      L
E2RLD4_HRK-01          L
                        

© 1998-2018