Dataset for protein Egl-1 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E3MP30_EGL1-01          MLSLL---------------CDF-----VKPFYSNNFKNMMFFDFHTSSL
O61667_EGL1-01          MLMLTFASTSSDLLPMSNVFDVQ-----SSVFY--NEKNMFYSSSQDFSS
E3LTJ5_EGL1-01          MLTFASSSSSDLFLSMPNSHFDI-----VKPFCCINEKKIMCSDYCNTSS
G0NM76_EGL1-01          MLTFA-STSSDLLLPMPPSTSHFDNIVTIKPFF--DKNMMLYSEFSSAQD
A0A2H2IAN0_EGL1-01      MLAFT--TSPSTSSILLSHFDDI-----STSVC--SSKDMFFSYATPSCS
E3M1A5_EGL1-01          MLTFA--SSSDLLISMPSSHYDF-----VKPFY--SNKNMLFSDFPTSSD
                        ** :                         . .   . : ::         

E3MP30_EGL1-01          HA----VTSSEFAEDSGFLDSSKTSHYIHERSKEIGTKLTTMCDGFDAKM
O61667_EGL1-01          CE-----DSSQFADDSGFFDDSEIS----SIGYEIGSKLAAMCDDFDAQM
E3LTJ5_EGL1-01          DD---ASTSSEFADDSGFFDDSETDDYITKTAYEIGTKLVAMCDDFDAQM
G0NM76_EGL1-01          FDGMTTTTSSDFADDSGFFDDSETS-NISDIGYKIGTQLAAMCDDFDAEM
A0A2H2IAN0_EGL1-01      LE--VTADSDDSLDDSGFFDDSDAI----QIGREIGARIATMCDEFDAEL
E3M1A5_EGL1-01          HA--VT--SSEFADDSEFFDSSETSHYIHEISQEIGTKLAAMCDDFDAKM
                                *.:  :** *:*.*.      . . :**:.:.:*** ***::

E3MP30_EGL1-01          MSYSRSESTSRSLLGRFYDFFAF
O61667_EGL1-01          MSYS-AHASDRSLFHRLLDFFAF
E3LTJ5_EGL1-01          MSYS-RTVPSRSILSRVFDFFAF
G0NM76_EGL1-01          MSYS-SRCRSKSLLDRILDFFIF
A0A2H2IAN0_EGL1-01      MSFANYPAKDRGLLARVLDFFAF
E3M1A5_EGL1-01          MSYSRSGSTSRSLLGRFLDFFAF
                        **::     ...:: *. *** *

© 1998-2018