Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

713 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
K7E5Y2_BBC3-01          VRLGEAPGKPLSPGCGSGQRGPGGAGSGGAGRGGGSRSRRRSLSSPALAS
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JLM2_BAD-01       --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
A0A3Q2QC80_BAD-01       --------------------------------------------------
A0A3Q3MLA0_BAD-02       --------------------------------------------------
A0A3Q3MLA0_BAD-03       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-02       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WIZ8_BAD-02       --------------------------------------------------
A0A3P8WIZ8_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-02       --------------------------------------------------
A0A3P9A5G8_BAD-01       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A3B5K831_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-02       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A3Q3MLA0_BAD-01       --------------------------------------------------
G1SS60_BAD-01           --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
A0A337SAW2_BAD-01       ----------------------------------------MGTPENPLSA
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z697_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0C1_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2I3MCN5_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-02       --------------------------------------------------
F7GVS7_BAD-02           --------------------------------------------------
A0A2K6E7J3_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-03       --------------------------------------------------
A0A2K5HKW9_BAD-02       --------------------------------------------------
A0A2K6N1A1_BAD-02       --------------------------------------------------
A0A2K6PUM5_BAD-02       --------------------------------------------------
A0A2K5M0C1_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-03       --------------------------------------------------
F7GVS7_BAD-03           --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2I3MCN5_BAD-02       --------------------------------------------------
A0A2K6E7J3_BAD-03       --------------------------------------------------
A0A2I2Z8C7_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z697_BAD-03       --------------------------------------------------
F6SJL0_BAD-02           --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G3VRY4_BAD-02           --------------------------------------------------
G3VRY4_BAD-01           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
O35147_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A2K5E6K7_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5M0C1_BAD-01       --------------------------------------------------
A0A2K5VCD8_BAD-01       --------------------------------------------------
F7GVS7_BAD-01           --------------------------------------------------
A0A2K6E7J3_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2I3MCN5_BAD-04       --------------------------------------------------
A0A2K6N1A1_BAD-01       --------------------------------------------------
A0A2K6PUM5_BAD-01       --------------------------------------------------
A0A2K5HKW9_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F6SJL0_BAD-01           --------------------------------------------------
A0A2I3MCN5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z697_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
I3MBM5_BAD-01           --------------------------------------------------
I3MBM5_BAD-02           --------------------------------------------------
Q61337_BAD-05           --------------------------------------------------
Q61337_BAD-04           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
Q61337_BAD-06           --------------------------------------------------
Q61337_BAD-02           --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
F6TGJ4_BMF-01           --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
I3MDS9_BMF-02           --------------------------------------------------
A0A287AIU8_BMF-05       --------------------------------------------------
A0A287AIU8_BMF-04       --------------------------------------------------
A0A287AIU8_BMF-03       --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A2K5KGR6_BMF-01       --------------------------------------------------
A0A2K6FFR1_BMF-02       --------------------------------------------------
M3WRS0_BMF-02           --------------------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
F7HPK0_BMF-02           --------------------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
G3QIN5_BMF-02           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
G7PAW6_BMF-01           --------------------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A2AV74_BMF-01           ---------------------------------------------MPGAG
Q8K589_BMF-01           --------------------------------------------------
I3MDS9_BMF-01           ---------------------------------------------MPRAG
G3T7Z4_BMF-01           ---------------------------------------------MPRAG
F6X3N6_BMF-01           --------------------------------------------------
G3WDQ2_BMF-01           --------------------------------------------------
Q96LC9_BMF-06           --------------------------------------------------
F6TJI0_BMF-02           --------------------------------------------------
F6TJI0_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
J9PB65_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
M3WRS0_BMF-01           --------------------------------------------------
A0A2U4BC98_BMF-01       --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
A0A2K6FFR1_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A2K5MJY6_BMF-02       --------------------------------------------------
A0A2K5KGR6_BMF-02       --------------------------------------------------
G7PAW6_BMF-02           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5G4_BMF-01       --------------------------------------------------
A0A2K6B5G4_BMF-02       --------------------------------------------------
A0A2K6B5G4_BMF-04       --------------------------------------------------
A0A2K5Z4C3_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-03       --------------------------------------------------
A0A2K6L933_BMF-01       --------------------------------------------------
A0A2K6RAW8_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
F7HPK0_BMF-01           --------------------------------------------------
A0A2K5E1W9_BMF-01       --------------------------------------------------
A0A2K6TW86_BMF-02       --------------------------------------------------
A0A2K6TW86_BMF-01       --------------------------------------------------
G3QIN5_BMF-01           --------------------------------------------------
Q96LC9_BMF-01           --------------------------------------------------
Q96LC9_BMF-04           --------------------------------------------------
Q96LC9_BMF-03           --------------------------------------------------
Q96LC9_BMF-02           --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
H9GL49_BMF-01           --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
A9XRG9_BMF-01           --------------------------------------------------
A9XRG9_BMF-02           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
H0ZMX5_BMF-01           --------------------------------------------------
A9XRG9_BMF-03           --------------------------------------------------
A9XRG9_BMF-04           --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2E3E8_BMF-02       --------------------------------------------------
A0A3Q2E3E8_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-04       --------------------------------------------------
A0A3B3I0V9_BMF-02       --------------------------------------------------
A0A3B3I0V9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-03       --------------------------------------------------
A0A3P9JM16_BMF-03       --------------------------------------------------
A0A3P9JM16_BMF-02       --------------------------------------------------
A0A3P9JM16_BMF-01       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3LME3_BMF-01       --------------------------------------------------
A0A3Q3LME3_BMF-02       --------------------------------------------------
A0A3Q3LME3_BMF-03       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3B5KWG6_BMF-01       --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
F6Z067_BAD-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
F1PUF4_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       ----------------------------------------MGRAGRGPGA
A0A3Q2GRS5_BCL2L11      ----------------------------------------MFPAAAAGAA
Q4KMV9_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-03       --------------------------------------------------
A0A452FCS1_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       -----------------------------------------MFPAAAAGA
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-03       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A452FCS1_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-02       --------------------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-01       --------------------------------------------------
                                                                          

A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
K7E5Y2_BBC3-01          PNCLGADGCRRAGAGGGSGAGRSVTSRGSRGARLQREAAAAAAAAEPAWE
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JLM2_BAD-01       --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
A0A3Q2QC80_BAD-01       -------------------------------------------------M
A0A3Q3MLA0_BAD-02       --------------------------------------------------
A0A3Q3MLA0_BAD-03       --------------------------------------MKCNNKCYHFIR
I3K7B6_BAD-01           --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-02       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WIZ8_BAD-02       --------------------------------------------------
A0A3P8WIZ8_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-02       --------------------------------------------------
A0A3P9A5G8_BAD-01       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A3B5K831_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-02       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A3Q3MLA0_BAD-01       --------------------------------------------------
G1SS60_BAD-01           --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
A0A337SAW2_BAD-01       PTHVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGRKRPRPLASPG
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z697_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0C1_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2I3MCN5_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-02       --------------------------------------------------
F7GVS7_BAD-02           --------------------------------------------------
A0A2K6E7J3_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-03       --------------------------------------------------
A0A2K5HKW9_BAD-02       --------------------------------------------------
A0A2K6N1A1_BAD-02       --------------------------------------------------
A0A2K6PUM5_BAD-02       --------------------------------------------------
A0A2K5M0C1_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-03       --------------------------------------------------
F7GVS7_BAD-03           --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2I3MCN5_BAD-02       --------------------------------------------------
A0A2K6E7J3_BAD-03       --------------------------------------------------
A0A2I2Z8C7_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z697_BAD-03       --------------------------------------------------
F6SJL0_BAD-02           --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G3VRY4_BAD-02           --------------------------------------------------
G3VRY4_BAD-01           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           -------------------------------------------------M
O35147_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A2K5E6K7_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5M0C1_BAD-01       --------------------------------------------------
A0A2K5VCD8_BAD-01       --------------------------------------------------
F7GVS7_BAD-01           --------------------------------------------------
A0A2K6E7J3_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2I3MCN5_BAD-04       --------------------------------------------------
A0A2K6N1A1_BAD-01       --------------------------------------------------
A0A2K6PUM5_BAD-01       --------------------------------------------------
A0A2K5HKW9_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F6SJL0_BAD-01           --------------------------------------------------
A0A2I3MCN5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z697_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
I3MBM5_BAD-01           -------------------------------------------------M
I3MBM5_BAD-02           -------------------------------------------------M
Q61337_BAD-05           --------------------------------------------------
Q61337_BAD-04           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
Q61337_BAD-06           --------------------------------------------------
Q61337_BAD-02           -------------------------------------------------M
Q61337_BAD-01           -------------------------------------------------M
I3LVX0_BIK-01           --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
F6TGJ4_BMF-01           --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
I3MDS9_BMF-02           --------------------------------------------------
A0A287AIU8_BMF-05       --------------------------------------------------
A0A287AIU8_BMF-04       --------------------------------------------------
A0A287AIU8_BMF-03       --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A2K5KGR6_BMF-01       --------------------------------------------------
A0A2K6FFR1_BMF-02       --------------------------------------------------
M3WRS0_BMF-02           --------------------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
F7HPK0_BMF-02           --------------------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
G3QIN5_BMF-02           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
G7PAW6_BMF-01           --------------------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A2AV74_BMF-01           VFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPIECGHQ
Q8K589_BMF-01           --------------------------------------------------
I3MDS9_BMF-01           VFWKQYRAVRSGLLRRPPESAAAAGPASGSRLP------------GSGVS
G3T7Z4_BMF-01           VFWKQYRTVLSLVHQRPPALAAAA--VRSPRLPPLPAELFPSFPIESGRQ
F6X3N6_BMF-01           --------------------------------------------------
G3WDQ2_BMF-01           --------------------------------------------------
Q96LC9_BMF-06           --------------------------------------------------
F6TJI0_BMF-02           --------------------------------------------------
F6TJI0_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-02       -----------------------------MPGAGVFWKQYRARRRRRGPD
J9PB65_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
M3WRS0_BMF-01           --------------------------------------------------
A0A2U4BC98_BMF-01       --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
A0A2K6FFR1_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A2K5MJY6_BMF-02       --------------------------------------------------
A0A2K5KGR6_BMF-02       --------------------------------------------------
G7PAW6_BMF-02           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5G4_BMF-01       --------------------------------------------------
A0A2K6B5G4_BMF-02       --------------------------------------------------
A0A2K6B5G4_BMF-04       --------------------------------------------------
A0A2K5Z4C3_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-03       --------------------------------------------------
A0A2K6L933_BMF-01       --------------------------------------------------
A0A2K6RAW8_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
F7HPK0_BMF-01           --------------------------------------------------
A0A2K5E1W9_BMF-01       --------------------------------------------------
A0A2K6TW86_BMF-02       --------------------------------------------------
A0A2K6TW86_BMF-01       --------------------------------------------------
G3QIN5_BMF-01           --------------------------------------------------
Q96LC9_BMF-01           --------------------------------------------------
Q96LC9_BMF-04           --------------------------------------------------
Q96LC9_BMF-03           --------------------------------------------------
Q96LC9_BMF-02           --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
H9GL49_BMF-01           --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
A9XRG9_BMF-01           --------------------------------------------------
A9XRG9_BMF-02           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
H0ZMX5_BMF-01           --------------------------------------------------
A9XRG9_BMF-03           --------------------------------------------------
A9XRG9_BMF-04           --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2E3E8_BMF-02       --------------------------------------------------
A0A3Q2E3E8_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-04       --------------------------------------------------
A0A3B3I0V9_BMF-02       --------------------------------------------------
A0A3B3I0V9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-03       --------------------------------------------------
A0A3P9JM16_BMF-03       --------------------------------------------------
A0A3P9JM16_BMF-02       --------------------------------------------------
A0A3P9JM16_BMF-01       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3LME3_BMF-01       --------------------------------------------------
A0A3Q3LME3_BMF-02       --------------------------------------------------
A0A3Q3LME3_BMF-03       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3B5KWG6_BMF-01       --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3B4CPH6_BAD-01       ------------------------------------------------MA
F6Z067_BAD-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
F1PUF4_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       AQSVQAPRRVPAFCPVAGGSERAAARFPAPAGADSERRGLAEELLLEPDS
A0A3Q2GRS5_BCL2L11      RARGAARGALGCPAERGGGGRAASGRLCAVLAPLSASPGLCLPRCLSGDN
Q4KMV9_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-03       --------------------------------------------------
A0A452FCS1_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       ARARGAARGALGCRTARGGGRAASGRLCAAPGALKASPRLCLPRFFRAEG
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-03       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A452FCS1_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-02       --------------------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-01       --------------------------------------------------
                                                                          

A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
K7E5Y2_BBC3-01          PAAQDTCVRPAGATAGAGAGAVASGGGDRGGGSSSSSSSSSSSSSSRGSS
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
A0A3P8RLE2_BCL2L11      ---------------------------------------------ANRTP
A0A3B1JLM2_BAD-01       ---------------------------------MSNQYLLKLRRARFNCD
A0A3Q2LHE3_BIK-02       --------------------------------------------MRKRRR
E7FBJ6_BAD-01           -------------------------------------------------M
B5XEF1_BAD-01           --------------------------------------------------
H3D8J8_BAD-01           ------------------------------------------MAAKFSLC
A0A3B5L9R9_BAD-01       ------------------------------------------MDTKFTI-
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B1IH05_BAD-01       ----------------MSTAARAAAGTCDSTAVSQPSKLDFTMDHMFTI-
A0A3Q2QC80_BAD-01       SPSSSSHIGCFPYPLRNQINSSPSCTFISGLNFPNSCLPDDTMAAKFTI-
A0A3Q3MLA0_BAD-02       ------------------------------------------MAAKFTI-
A0A3Q3MLA0_BAD-03       LVFVKKQSVICAGYGTVNTFGPAYSRDSTENKISCLGVLDVTMAAKFTI-
I3K7B6_BAD-01           ------------------------------------------MAANFTI-
A0A3P9B2E4_BAD-01       ------------------------------------------MAANFKI-
A0A3Q3C680_BAD-01       ------------------------------------------MAANFKI-
A0A3P8QRJ7_BAD-01       ------------------------------------------MAANFKI-
A0A3Q4GGN3_BAD-01       ------------------------------------------MAANFKI-
A0A3B4GXJ6_BAD-01       ------------------------------------------MAANFKI-
A0A3Q2D5S0_BAD-01       -------------------------------MAQSVETSDPIMAATFTI-
A0A3B3BQF7_BAD-01       ------------------------------------------MAAKFSI-
A0A3Q1K1C7_BAD-02       ------------------------------------------MAARFTI-
A0A3Q1K1C7_BAD-01       ------------------------------------------MAARFTI-
A0A3Q1GWH9_BAD-01       ------------------------------------------MAAKFSI-
A0A3Q1CPU7_BAD-01       ------------------------------------------MAAKFTI-
A0A3P8TWH6_BAD-01       ------------------------------------------MAAKFTI-
A0A2U9BAC9_BAD-01       ------------------------------------------MAANFTI-
A0A3B4VFC5_BAD-01       ------------------------------------------MAANFTI-
A0A3B4W9T1_BAD-01       ------------------------------------------MAANFTI-
A0A3Q0QNQ2_BAD-01       ------------------------------------------FIHFLPF-
A0A3P8WIZ8_BAD-02       ------------------------------MNVEVSIFPDVTMAAQFTI-
A0A3P8WIZ8_BAD-01       ------------------------------------------MAAQFTI-
A0A3P9A5G8_BAD-02       ------------------------------------------MAFKMDHT
A0A3P9A5G8_BAD-01       ------------------------------------------MAFKMDHT
B5X1T1_BAD-01           ----------------------------------------------MDHT
H3ANP3_BAD-03           ---------------------------------------------MFQI-
H3ANP3_BAD-04           ---------------------------------------------MFQI-
H3ANP3_BAD-02           ---------------------------------------------MFQI-
H3ANP3_BAD-01           ---------------------------------------------MFQI-
A0A3B3QX41_BAD-01       -------------------------------------MSGVTMAHMFTIS
Q4V925_BAD-02           ------------------------------------------MAHMFNIS
Q4V925_BAD-03           ------------------------------------------MAHMFNIS
A7MCM4_BAD-01           ------------------------------------------MAHMFNIS
Q4V925_BAD-04           ------------------------------------------MAHMFNIS
Q4V925_BAD-01           ------------------------------------------MAHMFNIS
A0A3P8Y761_BAD-01       ------------------------------------------MENIFTI-
A0A3B5K831_BAD-01       ------------------------------------------MATRFSIS
A0A3B5Q2N7_BAD-01       ------------------------------------------MDTKFTI-
A0A087X8P8_BAD-01       ------------------------------------------MDAKFTI-
A0A3B3UA11_BAD-01       ------------------------------------------MDAKFTI-
A0A3B3YFR1_BAD-01       ------------------------------------------MDAKFTI-
A0A3P9Q7C3_BAD-01       ------------------------------------------MDAKFTI-
A0A3B3HDU2_BAD-01       ------------------------------------------MAAKFTI-
A0A3B5BAL2_BAD-01       ------------------------------------------MAAQFSI-
A0A3Q3AEL8_BAD-02       ------------------------------------------MAAKFTI-
A0A3Q3AEL8_BAD-01       ------------------------------------------MAAKFTI-
G3Q8B3_BAD-01           ------------------------------------------MAAHFTI-
A0A3Q2Y0E4_BAD-01       ------------------------------------------MAANFSI-
A0A3Q3R5S3_BAD-01       ------------------------------------------MAANFTI-
A0A3Q3RXS8_BAD-02       ------------------------------------------MAAKFS-I
A0A3Q3RXS8_BAD-01       ------------------------------------------MAAKFS-I
A0A3Q0QNQ2_BAD-02       -------------------------------------------------M
A0A3Q3WTY4_BAD-01       ------------------------------------------MATNFTIS
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      -------------------------LLSARKARFSVCPCSSPEDRIHHL-
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      -----------------------------------------------MF-
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      ------------------------------------------------M-
A0A3B4V919_BCL2L11      ------------------------------------MKAQADGAALFIQ-
A0A3B4XZH1_BCL2L11      ------------------------------------MKAQADGAALFIQ-
A0A3Q3ESW6_BCL2L11      -----------------------------------------------MH-
A0A3Q2SZH6_BCL2L11      --------------------------------------------MVTLC-
A0A3B3VNE0_BCL2L11      ------------------------------------------------M-
A0A3B3YII5_BCL2L11      ------------------------------------------------M-
A0A3B3YII5_BCL2L11      ------------------------------------------------M-
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      -----------------------------------------------MR-
A0A3B5M375_BCL2L11      ------------------------------------------MLTVTLC-
A0A3B5QAM1_BCL2L11      ------------------------------------------------M-
A0A3B5QAM1_BCL2L11      ------------------------------------------MLTVTLC-
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          ---------------------------------------------QAPG-
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      ---------------------------------------------QAPG-
B4DQK3_BBC3-01          ---------------------------------------------MAPG-
A0A3Q3MLA0_BAD-01       ---------------------------------MTLTASDVTMAAKFTI-
G1SS60_BAD-01           --------------------------------------------------
K7E5Y2_BBC3-02          ----------------------MARAQQDGSSPEPVEGLPRESPRTFPL-
A0A3B4DUY7_BAD-01       ---------------------------------MSNQYLQKLRRARFNC-
A0A337SAW2_BAD-01       DISKADWAGSVTVPVAQATRAGLPQYWREAAGPGQGPRDRAWAQSMFQI-
A0A2I3TBK7_BAD-01       ---------------------------------------------MFQI-
A0A2R8Z697_BAD-02       ---------------------------------------------MFQI-
A0A2I2Z8C7_BAD-03       ---------------------------------------------MFQI-
Q92934_BAD-03           ---------------------------------------------MFQI-
A0A2K5M0C1_BAD-02       ---------------------------------------------MFQI-
A0A2K5XJR2_BAD-02       ---------------------------------------------MFQI-
A0A2I3MCN5_BAD-03       ---------------------------------------------MFQI-
A0A2K5VCD8_BAD-02       ---------------------------------------------MFQI-
F7GVS7_BAD-02           ---------------------------------------------MFQI-
A0A2K6E7J3_BAD-02       ---------------------------------------------MFQI-
A0A2K5E6K7_BAD-02       ---------------------------------------------MFQI-
A0A2K6TG62_BAD-02       ---------------------------------------------MFQI-
A0A2K5E6K7_BAD-03       ---------------------------------------------MFQI-
A0A2K5HKW9_BAD-02       ---------------------------------------------MFQI-
A0A2K6N1A1_BAD-02       ---------------------------------------------MFQI-
A0A2K6PUM5_BAD-02       ---------------------------------------------MFQI-
A0A2K5M0C1_BAD-03       ---------------------------------------------MFQI-
A0A2K5VCD8_BAD-03       ---------------------------------------------MFQI-
F7GVS7_BAD-03           ---------------------------------------------MFQI-
A0A2K5XJR2_BAD-03       ---------------------------------------------MFQI-
A0A2I3MCN5_BAD-02       ---------------------------------------------MFQI-
A0A2K6E7J3_BAD-03       ---------------------------------------------MFQI-
A0A2I2Z8C7_BAD-04       ---------------------------------------------MFQI-
Q92934_BAD-04           ---------------------------------------------MFQI-
A0A2I3TBK7_BAD-03       ---------------------------------------------MFQI-
A0A2R8Z697_BAD-03       ---------------------------------------------MFQI-
F6SJL0_BAD-02           ---------------------------------------------MFQI-
A0A2K6TG62_BAD-03       ---------------------------------------------MFQI-
G3VRY4_BAD-02           ---------------------------------------------MFQI-
G3VRY4_BAD-01           ---------------------------------------------MFQI-
G1P8C5_BAD-01           ----------------------------------------PTAQSMFQI-
A0A452ER54_BAD-02       --------------------------------------YRAWAQSMFQI-
W5P8G9_BAD-01           ----------------------------------QGPRYRAWAQSMFQI-
G3TP47_BAD-01           ------GPPENPSPASTHAQGVRMSGAEHPEKKKGRRRSSGGLQSMFQI-
G1MI17_BAD-01           -VGTPENPSSAPTHGPGKRKSGTDR--RETRKGPRTTALAPTAQSMFQI-
A0A287AEF3_BAD-01       -MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSGPASQSMFQI-
M3YNE7_BAD-01           ---------------------------------------------MFQI-
A0A452RJM6_BAD-01       ---------------------------------------------MFQI-
A0A384DJL2_BAD-01       ---------------------------------------------MFQI-
A0A452ER54_BAD-01       ---------MGTPENPSAAPTTRKLSIRRRRRESGGRQWAGPRGSMFQI-
F1MUT9_BAD-01           ---------------------------------------------MFQI-
Q3SYZ0_BAD-01           ---------------------------------------------MFQI-
F7DN67_BAD-01           GTPENPSPAPTHAQGTRKSTAEHPETRRGPRKEGGGRRAGPAAGSMFQI-
O35147_BAD-01           ---MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQI-
H0WVR2_BAD-01           ---------------------------------------------MFQI-
H0V608_BAD-01           ---------------------------------------------MFQI-
A0A2K5E6K7_BAD-01       ---------------------------------------------MFQI-
A0A2K6TG62_BAD-01       ---------------------------------------------MFQI-
A0A0D9R491_BAD-01       ---------------------------------------------MFQI-
A0A2K5M0C1_BAD-01       ---------------------------------------------MFQI-
A0A2K5VCD8_BAD-01       ---------------------------------------------MFQI-
F7GVS7_BAD-01           ---------------------------------------------MFQI-
A0A2K6E7J3_BAD-01       ---------------------------------------------MFQI-
A0A2K5XJR2_BAD-01       ---------------------------------------------MFQI-
A0A2I3MCN5_BAD-04       ---------------------------------------------MFQI-
A0A2K6N1A1_BAD-01       ---------------------------------------------MFQI-
A0A2K6PUM5_BAD-01       ---------------------------------------------MFQI-
A0A2K5HKW9_BAD-01       ---------------------------------------------MFQI-
B4DZQ9_BAD-01           ---------------------------------------------MFQI-
A0A2K6GWV0_BAD-01       ---------------------------------------------MFQI-
F6SJL0_BAD-01           ---------------------------------------------MFQI-
A0A2I3MCN5_BAD-01       ---------------------------------------------MFQI-
A0A2I2Z8C7_BAD-02       ---------------------------------------------MFQI-
A0A2I2Z8C7_BAD-01       ---------------------------------------------MFQI-
Q92934_BAD-01           ---------------------------------------------MFQI-
Q92934_BAD-02           ---------------------------------------------MFQI-
A0A2I3TBK7_BAD-02       ---------------------------------------------MFQI-
A0A2R8Z697_BAD-01       ---------------------------------------------MFQI-
A0A2J8TYJ3_BAD-01       ---------------------------------------------MFQI-
F1PK10_BAD-01           -----TPENPSSAPAQDPGTRKSGTERREKSCALTTCCLAPTAQSMFQI-
Q45KI9_BAD-01           ---------------------------------------------MFQI-
I3MBM5_BAD-01           GIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHPAWTQSMFQI-
I3MBM5_BAD-02           GIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHPAWTQSMFQI-
Q61337_BAD-05           ---------------------------------------------MFQI-
Q61337_BAD-04           ---------------------------------------------MFQI-
Q61337_BAD-03           ---------------------------------------------MFQI-
Q61337_BAD-06           ---------------------------------------------MFQI-
Q61337_BAD-02           GTPKQPSLAPAHALGLRKS---DPGIRSLGSDAGGRRWRPA-AQSMFQI-
Q61337_BAD-01           GTPKQPSLAPAHALGLRKS---DPGIRSLGSDAGGRRWRPA-AQSMFQI-
I3LVX0_BIK-01           ---------------------------------MVQGSHQVALRLAC-IG
A0A3G3M2M0_BCL2L11      ----------------------------MSDTSREQTPGNVPASRGSGES
A0A3Q1ELG4_BCL2L11      ----------------------------SSSAASPAAPHADTTEGGGADP
A0A3Q1CI15_BCL2L11      ----------------------------PTKSGPDAAARCFTSGSRCRDS
O61667_EGL1-01          -------------------MLMLTFASTSSDLLPMSNVFDVQSSVFYNEK
Q9BXH1_BBC3-03          ------------------------MKFGMGSAQACPCQVPRAASTTWVPC
F6TGJ4_BMF-01           -------------------------------QESYLNMDE-------LDD
A0A452H3N6_BMF-01       -------------------------------MDPPNYLEDDYSSLDGLDD
G1PAU1_BMF-01           -------------------------------MEPPQCVEE-------LED
A2AV74_BMF-02           --------------------------MSPGEMEPPQCVEE-------LED
A0A286XXB0_BMF-03       --------------------------VFPREMEPPQCVEE-------LED
I3MDS9_BMF-02           --------------------------VFPEEMEPPQCVEE-------LED
A0A287AIU8_BMF-05       -------------------------------MEPPQCVEE-------LED
A0A287AIU8_BMF-04       -------------------------------MEPPQCVEE-------LED
A0A287AIU8_BMF-03       -------------------------------MEPPQCVEE-------LED
A0A287AIU8_BMF-01       -------------------------------MEPPQCVEE-------LED
A0A287AIU8_BMF-02       -------------------------------MEPPQCVEE-------LED
A0A2K5KGR6_BMF-01       -------------------------------MEPSRCVEE-------LED
A0A2K6FFR1_BMF-02       -------------------------------MEPSHCVEE-------LED
M3WRS0_BMF-02           -------------------------------MEPPQCVEE-------LED
A0A2K5E1W9_BMF-02       -------------------------------MEPSQCVEE-------LED
F7HPK0_BMF-02           -------------------------------MEPSQCVEE-------LED
A0A2K6TW86_BMF-03       -------------------------------MEPSQCVEE-------LED
A0A2K6RAW8_BMF-02       -------------------------------MEPSRCVEE-------LED
G3QIN5_BMF-02           -------------------------------MEPSQCVEE-------LED
Q96LC9_BMF-07           -------------------------------MEPSQCVEE-------LED
Q96LC9_BMF-05           -------------------------------MEPSQCVEE-------LED
A0A2R9BS98_BMF-02       -------------------------------MEPSQCVEE-------LED
A0A2J8QDD5_BMF-01       -------------------------------MEPSQCVEE-------LED
A0A2K5MJY6_BMF-01       -------------------------------MEPSRCVEE-------LED
G7PAW6_BMF-01           -------------------------------MEPSRCVEE-------LED
A0A2K6B5G4_BMF-03       -------------------------------MEPSRCVEE-------LED
A0A2K5Z4C3_BMF-02       -------------------------------MEPSRCVEE-------LED
A0A096NTE9_BMF-03       -------------------------------MEPSRCVEE-------LED
A0A2I3HD83_BMF-01       -------------------------------MEPSQCVEE-------LED
A2AV74_BMF-01           APRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEE-------LED
Q8K589_BMF-01           -------------------------------MEPPQCVEE-------LED
I3MDS9_BMF-01           LPQVFITLDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEE-------LED
G3T7Z4_BMF-01           APRVLVTLDPGAEPWRHDPETDTLSWSHPGEMEPSQCVEE-------LED
F6X3N6_BMF-01           -------------------------------MEPPHYVEE-------LED
G3WDQ2_BMF-01           -------------------------------MESPHYVEE-------LED
Q96LC9_BMF-06           -------------------------------MEPSQCVEE-------LED
F6TJI0_BMF-02           -------------------------------MEPPQCVEE-------LED
F6TJI0_BMF-01           -------------------------------MEPPQCVEE-------LED
A0A286XXB0_BMF-02       PPRVFVTLDPGTEPWHHDSEADSLSWSHPGEMEPPQCVEE-------LED
J9PB65_BMF-01           -------------------------------MEPPQCVEE-------LED
A0A286XXB0_BMF-01       -------------------------------MEPPQCVEE-------LED
G1SR62_BMF-01           -------------------------------MEPPQCVEE-------LED
W5QFV1_BMF-01           ---------------------------LTGEMEPPQCVEE-------LED
Q05KI3_BMF-01           -------------------------------MEPPQCVEE-------LED
Q05KI3_BMF-02           -------------------------------MEPPQCVEE-------LED
A0A452F2E0_BMF-02       -------------------------------MEPPQCVEE-------LED
A0A452F2E0_BMF-01       -------------------------------MEPPQCVEE-------LED
M3WRS0_BMF-01           -------------------------------MEPPQCVEE-------LED
A0A2U4BC98_BMF-01       -------------------------------MEPPQCVEE-------LED
M3YAD5_BMF-01           -------------------------------MEPPQCVEE-------LED
A0A452SED0_BMF-01       -------------------------------MEPPQCVEE-------LED
A0A384D070_BMF-01       -------------------------------MEPPQCVEE-------LED
A0A2K6FFR1_BMF-01       -------------------------------MEPSHCVEE-------LED
H0WYH6_BMF-01           -------------------------------MEPSQCVEE-------LED
A0A096NTE9_BMF-01       -------------------------------MEPSRCVEE-------LED
A0A2K6L933_BMF-02       -------------------------------MEPSRCVEE-------LED
A0A096NTE9_BMF-02       -------------------------------MEPSRCVEE-------LED
A0A2K5MJY6_BMF-02       -------------------------------MEPSRCVEE-------LED
A0A2K5KGR6_BMF-02       -------------------------------MEPSRCVEE-------LED
G7PAW6_BMF-02           -------------------------------MEPSRCVEE-------LED
F7CM09_BMF-02           -------------------------------MEPSRCVEE-------LED
A0A2K6B5G4_BMF-01       -------------------------------MEPSRCVEE-------LED
A0A2K6B5G4_BMF-02       -------------------------------MEPSRCVEE-------LED
A0A2K6B5G4_BMF-04       -------------------------------MEPSRCVEE-------LED
A0A2K5Z4C3_BMF-01       -------------------------------MEPSRCVEE-------LED
A0A2K6L933_BMF-03       -------------------------------MEPSRCVEE-------LED
A0A2K6L933_BMF-01       -------------------------------MEPSRCVEE-------LED
A0A2K6RAW8_BMF-01       -------------------------------MEPSRCVEE-------LED
A0A0D9R4R5_BMF-01       -------------------------------MEPSRCVEE-------LED
F7HPK0_BMF-01           -------------------------------MEPSQCVEE-------LED
A0A2K5E1W9_BMF-01       -------------------------------MEPSQCVEE-------LED
A0A2K6TW86_BMF-02       -------------------------------MEPSQCVEE-------LED
A0A2K6TW86_BMF-01       -------------------------------MEPSQCVEE-------LED
G3QIN5_BMF-01           -------------------------------MEPSQCVEE-------LED
Q96LC9_BMF-01           -------------------------------MEPSQCVEE-------LED
Q96LC9_BMF-04           -------------------------------MEPSQCVEE-------LED
Q96LC9_BMF-03           -------------------------------MEPSQCVEE-------LED
Q96LC9_BMF-02           -------------------------------MEPSQCVEE-------LED
A0A2R9BS98_BMF-01       -------------------------------MEPSQCVEE-------LED
A0A2J8QDD5_BMF-02       -------------------------------MEPSQCVEE-------LED
A0A2J8T301_BMF-01       -------------------------------MEPSQCVEE-------LED
H9GL49_BMF-01           -------------------------------MDPPGYLDDDFSTLDGLED
K7FRX2_BMF-01           -------------------------------MDPPSYLEEDYSSLDGLDD
A9XRG9_BMF-01           -------------------------------MDRPSYLEEDYSSLDGLDD
A9XRG9_BMF-02           -------------------------------MDRPSYLEEDYSSLDGLDD
U3JS06_BMF-01           -------------------------------MDRPSYLEEDYSSLDGLDD
H0ZMX5_BMF-01           -------------------------------MDRPSYLEEDYSSLDGLDD
A9XRG9_BMF-03           -------------------------------MDRPSYLEEDYSSLDGLDD
A9XRG9_BMF-04           -------------------------------MDRPSYLEEDYSSLDGLDD
G1NHG8_BMF-01           -------------------------------MDRPSYLEEDYSSLDGLDD
A0A3B4UNJ0_BMF-01       -------------------------------------MDD-------EEE
B2KKY9_BCL2L11-01       -------------------------------------MSD-------TSR
B8JK68_BCL2L11-01       -------------------------------------MSD-------TSR
A0A3B4B6Y3_BMF-01       -------------------------------------MED-------EED
Q0GKC7_BMF-01           -------------------------------------MDE-------DED
A0A3B3RH63_BMF-01       -------------------------------------MDD-------DDD
W5N4P7_BMF-01           -------------------------------------MEE-------DED
A0A3B1K1X5_BMF-01       -------------------------------------MDD-------EED
A0A3B4CNJ8_BMF-01       -------------------------------------MDE-------DED
A0A2U9CJH3_BMF-01       -------------------------------------MDD-------EED
A0A3Q2YCX7_BMF-01       -------------------------------------MED-------EED
A0A3Q2YCX7_BMF-02       -------------------------------------MED-------EED
A0A3P8ZIE7_BMF-01       -------------------------------------MED-------EED
A0A3Q3QZ16_BMF-01       -------------------------------------MDD-------EED
A0A3Q3QZ16_BMF-02       -------------------------------------MDD-------EED
A0A3Q2PJX9_BMF-02       -------------------------------------MED-------EED
A0A3Q2PJX9_BMF-03       -------------------------------------MED-------EED
A0A3Q2PJX9_BMF-01       -------------------------------------MED-------EED
A0A3B5QK08_BMF-01       -------------------------------------MED-------EED
A0A3B5QK08_BMF-02       -------------------------------------MED-------EED
A0A096LRV0_BMF-01       -------------------------------------MED-------EED
A0A3B3WU80_BMF-01       -------------------------------------MED-------EED
A0A3P9Q8E2_BMF-01       -------------------------------------MED-------EED
A0A3Q2E3E8_BMF-02       -------------------------------------MEE-------EED
A0A3Q2E3E8_BMF-01       -------------------------------------MEE-------EED
A0A3Q3GUU5_BMF-01       -------------------------------------MDD-------EED
A0A3B5B8F6_BMF-01       -------------------------------------MDD-------EED
A0A3P8UA78_BMF-01       -------------------------------------MDD-------EED
A0A3P8UA78_BMF-03       -------------------------------------MDD-------EED
A0A3P8UA78_BMF-02       -------------------------------------MDD-------EED
A0A3B3CGR9_BMF-01       -------------------------------------MDD-------EED
A0A3B3I0V9_BMF-04       -------------------------------------MDD-------EED
A0A3B3I0V9_BMF-02       -------------------------------------MDD-------EED
A0A3B3I0V9_BMF-01       -------------------------------------MDD-------EED
A0A3B3I0V9_BMF-03       -------------------------------------MDD-------EED
A0A3P9JM16_BMF-03       -------------------------------------MDD-------EED
A0A3P9JM16_BMF-02       -------------------------------------MDD-------EED
A0A3P9JM16_BMF-01       -------------------------------------MDD-------EED
A0A3Q2ZA20_BMF-01       -------------------------------------MDD-------EED
A0A3P8NFE2_BMF-02       -------------------------------------MDD-------EED
I3K2D6_BMF-01           -------------------------------------MDD-------EED
A0A3P8NFE2_BMF-01       -------------------------------------MDD-------EED
A0A3Q3C5V2_BMF-01       -------------------------------------MDD-------EED
A0A3P9DPJ5_BMF-02       -------------------------------------MDD-------EED
A0A3P9DPJ5_BMF-01       -------------------------------------MDD-------EED
A0A3B4ETH0_BMF-01       -------------------------------------MDD-------EED
A0A3Q4G1I4_BMF-01       -------------------------------------MDD-------EED
A0A3Q1FVH7_BMF-01       -------------------------------------MDD-------EED
A0A3Q1FVH7_BMF-02       -------------------------------------MDD-------EED
A0A3Q1D1K3_BMF-01       -------------------------------------MDD-------EED
A0A3P8RKY9_BMF-01       -------------------------------------MDD-------EED
A0A3Q1IPR4_BMF-01       -------------------------------------MDD-------EED
A0A3B4U5H8_BMF-01       -------------------------------------MDD-------EED
A0A3B4WM88_BMF-01       -------------------------------------MDD-------EED
A0A3Q3LME3_BMF-01       -------------------------------------MDD-------EED
A0A3Q3LME3_BMF-02       -------------------------------------MDD-------EED
A0A3Q3LME3_BMF-03       -------------------------------------MDD-------EED
A0A3Q3VLX6_BMF-01       -------------------------------------MDD-------DED
A0A3B5KWG6_BMF-01       -------------------------------------MDD-------EED
A0A286XF37_PMAIP1-      ------------------------------------MPGKVCKSAQPNST
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
F1SMU1_PMAIP1-01        ---------------------------------ARAAAGAPTSEAFGRSG
A0A3B3QC78_BCL2L11      -----------------------------MGQILLTIPCSVCSAEDKITR
A0A3Q2U844_BCL2L11      ---------------------------------MAKQPPEAKAPRDR-RA
G3SU55_BCL2L11-01       ---------------------------------MAKQPSDVSSECDR-EG
G3W979_BCL2L11-01       ---------------------------------MAKQPSDLNSECDR-EG
A0A2K6KS56_BBC3-02      ---------------------------------LAERTWSRGASPGALAA
A0A3Q3SYA1_BCL2L11      -------------------------MATEESGDPPAGDPRVSAQTSRSNG
A0A2K5JY52_PMAIP1-      -----------------------------------------------MPG
A0A096MPU8_PMAIP1-      -----------------------------------------------MPG
A0A2K5ZWH1_PMAIP1-      -----------------------------------------------MPG
A0A2K5VPX2_PMAIP1-      -----------------------------------------------MPG
A0A2K6BV75_PMAIP1-      -----------------------------------------------MPG
A0A2K6KJF2_PMAIP1-      -----------------------------------------------MPG
A0A2K6NC45_PMAIP1-      -----------------------------------------------MPG
Q13794_PMAIP1-02        -----------------------------------------------MPG
A0A2R9AKC9_PMAIP1-      -----------------------------------------------MPG
A0A1D5QGJ8_PMAIP1-      -----------------------------------------------MPG
A0A2I2YVQ5_PMAIP1-      -----------------------------------------------MPG
A0A2I3SX38_PMAIP1-      -----------------------------------------------MPG
C1C3S9_BAD-01           -------------------------------MGDSPHKSMFSIEEF----
A0A3B4CPH6_BAD-01       HMFTLSDDSDTSEDLGDADQPEASKRAELSQSGQHPLVPERFRESRQ-RN
F6Z067_BAD-01           ------------------------------MADSSPSAVFKLEEFDN-EE
A0A3Q2LHE3_BIK-01       ------------------------------MSQVGPVSRDLFLDAFL-HE
A0A452QUG1_BIK-01       ------------------------------FHTTRRCAQRVVAPSLH-HQ
A0A452V3L2_BIK-01       -----------------MAWSSEEARSREEMSHTGPLSRNLFLSTFL-QE
M3XHJ5_BCL2L11-01       ---------------------------------------MPTEESLQ-FD
W5QCU2_BIK-01           ------------------------------MYQARPLSRNLFLYTFL-QN
O70337_BIK-04           --------------------------------------------------
O70337_BIK-01           ------------------------------MSEARLMARDV-IKTVP-HD
O70337_BIK-02           ------------------------------MSEARLMARDV-IKTVP-HD
Q925D2_BIK-01           ------------------------------MSEARLMARDI-IKTLL-HD
G1TZR9_BIK-01           ------------------------------MSEVRPGSRDLFQEALL-DE
H0W025_BIK-01           ------------------------------MSEAKPVARDPLMETPL-FE
A0A2K5CLG5_BIK-01       ------------------------------MSEVRPLSSDILMETLL-CE
F7FUT7_BIK-01           ------------------------------MSEVRPLSSDIFMETLL-CE
A0A2K6TBD7_BIK-01       ------------------------------MSEDRPLSSDILMETLL-CE
H2P4N6_BIK-01           ------------------------------MSEVRPISRDILMETLL-YE
G1S1X2_BIK-01           ------------------------------MSEVRPISRDILMESLL-YE
G3QCT2_BIK-01           ------------------------------MSEVRPLSRDILMETLL-YE
A0A2R8ZXD2_BIK-01       ------------------------------MSEVRPLSRDILMETLL-YE
H2QLU7_BIK-01           ------------------------------MSEVRPLSRDILMETLL-YE
Q13323_BIK-01           ------------------------------MSEVRPLSRDILMETLL-YE
A0A2K6MCW0_BIK-01       ------------------------------MSGVRPVSRDILMETLL-YE
A0A2K6QK74_BIK-01       ------------------------------MSGVRPVSRDILMETLL-YE
A0A0D9QZY8_BIK-01       ------------------------------MSGVRPISRHILMESLL-YE
A0A2K5VW94_BIK-01       ------------------------------MSGVRPISRDTLMETLL-YE
A0A2K6DBJ4_BIK-01       ------------------------------MSGVRPISRDTLMETLL-YE
A0A2K5J4Q7_BIK-01       ------------------------------MSGVRPISRDILMETLL-YE
A0A096NKG5_BIK-01       ------------------------------MSGVRPISRDILMETLL-YE
A0A2K5LDM6_BIK-01       ------------------------------MSGVRPISRDTWMETLL-YE
A0A2K5XSA1_BIK-01       ------------------------------MSGVRPISRDTLMETLL-YE
F1PUF4_BIK-01           ------------------------------MSHSGPLSRNLFLSTFL-QE
H0XAE7_BIK-01           ------------------------------MSAGRPVSMDHFMETFP-FE
A0A2K6FM79_BIK-01       ------------------------------MSEVRPVSTDLLMETFP-FE
A0A3P8XIA2_BCL2L11      ------------------------------------RESSCEGNQQS-RG
F7G1G0_HRK-01           -----------------------------------------MCPCPLHRG
P62816_HRK-03           -----------------------------------------MCPCPRHRG
P62817_HRK-01           -----------------------------------------MCPCPRHRG
A0A287A5N9_HRK-01       -----------------------------------------MCPCPLHRG
H2NIS8_HRK-01           -----------------------------------------MCPCPLHRD
A0A2K5KZ69_HRK-01       -----------------------------------------MCPCPLHRG
H2Q6Y8_HRK-01           -----------------------------------------MCPCPLHRG
G3UH24_HRK-01           -----------------------------------------MCPCPLHRG
A0A2K5BYA0_HRK-01       -----------------------------------------MCPCPLHRG
U3E722_HRK-01           -----------------------------------------MCPCPLHRG
A0A452DXE5_HRK-01       -----------------------------------------MCPCPLHRG
A0A0D9SC73_HRK-01       -----------------------------------------MCPCPLHRG
A0A3Q2IBL3_HRK-01       -----------------------------------------MCPCPLHRG
A0A337SQ56_HRK-01       -----------------------------------------MCPCPLHRG
G3QTJ6_HRK-01           -----------------------------------------MCPCPLHRG
O00198_HRK-01           -----------------------------------------MCPCPLHRG
A0A1D5R1E4_HRK-01       -----------------------------------------MCPCPLHRG
A0A2K6AYL7_HRK-01       -----------------------------------------MCPCPLHRG
G1QHD8_HRK-01           -----------------------------------------MCPCPLHRG
G1T7W1_HRK-01           -----------------------------------------MCPCPLHRG
H0Y001_HRK-01           -----------------------------------------MCPCPLHRG
A0A096N944_HRK-01       -----------------------------------------MCPCPLHRG
A0A2K6GL98_HRK-01       -----------------------------------------MCPCPLHRG
E2RLD4_HRK-01           -----------------------------------------MCPCPLHRG
F7GVS7_BAD-04           ---------------------------------MEEEPSPF-------RG
Q2PG01_BAD-01           ---------------------------------MEEEPSPF-------RG
A0A2I3H4B2_BAD-01       ---------------------------------MGEEPSPF-------RG
A0A452IFQ4_BAD-01       ------------------------------MFRIQEFPDEVFPGRGK-EA
K7GA86_BCL2L11-01       LLFRQSLSASYSLDAGKGDQ-------------MAKQPSDLNSECDG-EG
A0A3Q2GRS5_BCL2L11      QGAPGRRKARAGRRGARARTRRSEGKGRIKKDQMAKQPSDVSSECDR-EG
Q4KMV9_BCL2L11-01       ---------------------------------MAKQPSVLSPDCNSGEG
F7FTC8_BCL2L11-01       ---------------------------------MAKQPSDLNSECDS-EG
A0A2K6E226_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-11       ---------------------------------MAKQPSDVSSECDR-EG
F7HHA9_BCL2L11-08       ---------------------------------MAKQPSDVSSECDR-EG
O54918_BCL2L11-06       ---------------------------------MAKQPSDVSSECDR-EG
O54918_BCL2L11-08       ---------------------------------MAKQPSDVSSECDR-EG
O54918_BCL2L11-03       ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3HW02_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6TRZ5_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5HZI7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5NU92_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5Z8B6_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I2YQ13_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-15       ---------------------------------MAKQPSDVSSECDR-EG
A0A2R9CA99_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2J8JCT2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F7HHA9_BCL2L11-07       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5CAB2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5X2I7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3M6I1_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-07       ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-22       ---------------------------------MAKQPSDVSSECDR-EG
A0A452U4S4_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
C1KGB8_BCL2L11-01       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6GE31_BCL2L11      ---------------------------------MAKQPSDVGSECDR-EG
A0A337SW42_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-17       ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-10       ---------------------------------MAKQPSDVSSECDR-EG
A0A2I2YQ13_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-19       ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-13       ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3HW02_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2R9CA99_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2J8JCT2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5NU92_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5X2I7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F7HHA9_BCL2L11-05       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5Z8B6_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5HZI7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6KJP8_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6QIL2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O54918_BCL2L11-05       ---------------------------------MAKQPSDVSSECDR-EG
O88498_BCL2L11-02       ---------------------------------MAKQPSDVNSECDR-EG
A0A0D9RWE0_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-05       ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-25       ---------------------------------MAKQPSDVSSECDR-EG
F1SU81_BCL2L11-03       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6GE31_BCL2L11      ---------------------------------MAKQPSDVGSECDR-EG
A0A286XJN2_BCL2L11      ---------------------------------MAKQPSDVSCECDR-EG
A0A2K5CAB2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6TRZ5_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6QIL2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5NU92_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5HZI7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5X2I7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6E226_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5Z8B6_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3M6I1_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3M6I1_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6KJP8_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I2YQ13_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-02       ---------------------------------MAKQPSDVSSECDR-EG
A0A2R9CA99_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2J8JCT2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
H2P5E2_BCL2L11-01       ---------------------------------MAKQPSDVSSECDR-EG
A0A337SW42_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A452SBG5_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
Q2YDF0_BCL2L11-01       -MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDVSSECDR-EG
A0A287DFJ0_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
Q2YDF0_BCL2L11-03       ---------------------------------MAKQPSDVSSECDR-EG
A0A452FCS1_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5CAB2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5Z8B6_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6KJP8_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6QIL2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F6XMC1_BCL2L11-09       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6TRZ5_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5HZI7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2R9CA99_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2J8JCT2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5NU92_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5X2I7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F7HHA9_BCL2L11-09       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6E226_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3M6I1_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I2YQ13_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-06       ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-23       ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3HW02_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
M3YDI3_BCL2L11-01       QGAPGRRRTRAGRRGARARTRRSEGKGRTKKDQMAKQPSDVSSECDR-EG
F6XMC1_BCL2L11-02       ---------------------------------MAKQPSDVSSECDR-EG
F6XMC1_BCL2L11-01       ---------------------------------MAKQPSDVSSECDR-EG
F7CXT2_BCL2L11-01       ---------------------------------MAKQPSDLNSECDR-EG
O54918_BCL2L11-01       ---------------------------------MAKQPSDVSSECDR-EG
O88498_BCL2L11-01       ---------------------------------MAKQPSDVNSECDR-EG
A0A337SW42_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A337SW42_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5NU92_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5HZI7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I2YQ13_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-24       ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-08       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5X2I7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F7HHA9_BCL2L11-03       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6E226_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5Z8B6_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3HW02_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2R9CA99_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2J8JCT2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3M6I1_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6KJP8_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6QIL2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5CAB2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F6XMC1_BCL2L11-06       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6TRZ5_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5CAB2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6TRZ5_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5CAB2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F6XMC1_BCL2L11-04       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6TRZ5_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5NU92_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I2YQ13_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-18       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5X2I7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F7HHA9_BCL2L11-01       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6E226_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5Z8B6_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3HW02_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2R9CA99_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2J8JCT2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3M6I1_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6KJP8_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6QIL2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5NU92_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5HZI7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I2YQ13_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-16       ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-12       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5X2I7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F7HHA9_BCL2L11-06       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6E226_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5Z8B6_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3HW02_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2R9CA99_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2J8JCT2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3M6I1_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6KJP8_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6QIL2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5HZI7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6GE31_BCL2L11      ---------------------------------MAKQPSDVGSECDR-EG
A0A2K6GE31_BCL2L11      ---------------------------------MAKQPSDVGSECDR-EG
F6XMC1_BCL2L11-08       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6GE31_BCL2L11      ---------------------------------MAKQPSDVGSECDR-EG
A0A2K6GE31_BCL2L11      ---------------------------------MAKQPSDVGSECDR-EG
A0A287DFJ0_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A286XJN2_BCL2L11      ---------------------------------MAKQPSDVSCECDR-EG
A0A286XJN2_BCL2L11      ---------------------------------MAKQPSDVSCECDR-EG
A0A2K5CAB2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F6XMC1_BCL2L11-07       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6TRZ5_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F6XMC1_BCL2L11-05       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6TRZ5_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5CAB2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5NU92_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5HZI7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5X2I7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F7HHA9_BCL2L11-02       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6E226_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5Z8B6_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3M6I1_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6KJP8_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6QIL2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I2YQ13_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-09       ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-21       ---------------------------------MAKQPSDVSSECDR-EG
A0A2R9CA99_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2J8JCT2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5NU92_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5HZI7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5X2I7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F7HHA9_BCL2L11-04       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6E226_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5Z8B6_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3M6I1_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6KJP8_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6QIL2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I2YQ13_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-20       ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3HW02_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2R9CA99_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2J8JCT2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5CAB2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5CAB2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
F6XMC1_BCL2L11-03       ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6TRZ5_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6TRZ5_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6QIL2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6QIL2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5NU92_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5HZI7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5X2I7_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6E226_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6E226_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K5Z8B6_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3M6I1_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6KJP8_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2K6KJP8_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2I2YQ13_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
O43521_BCL2L11-03       ---------------------------------MAKQPSDVSSECDR-EG
A0A2I3HW02_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2R9CA99_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A2J8JCT2_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A337SW42_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
A0A452FCS1_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
W5PY58_BCL2L11-01       ---------------------------------MAKQPSDVSSECDR-EG
Q2YDF0_BCL2L11-02       ---------------------------------MAKQPSDVSSECDR-EG
F1SU81_BCL2L11-02       ---------------------------------MAKQPSDVSSECDR-EG
G1SSY0_BCL2L11-01       ---------------------------------MAKQPSDVSSECDR-EG
H0XW23_BCL2L11-01       ---------------------------------MAKQPSDVGSECDR-EG
A0A337SW42_BCL2L11      ---------------------------------MAKQPSDVSSECDR-EG
G1LDR8_BCL2L11-01       ---------------------------------MAKQPSDVSSECDR-EG
J9NWV6_BCL2L11-01       ---------------------------------MAKQPSDVSSECDR-EG
F1SU81_BCL2L11-01       ---------------------------------MAKQPSDVSSECDR-EG
                                                                          

A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
K7E5Y2_BBC3-01          RGSGGEQAARSQAPP----------------------------GRPGPRL
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
Q9BXH1_BBC3-04          -------------------------------------------MKFGM--
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
A0A3P8RLE2_BCL2L11      SLV--GPEQKKRNGG-----------------------------------
A0A3B1JLM2_BAD-01       EEG--YSQALNSRTS----------------------------TEGGGRD
A0A3Q2LHE3_BIK-02       HAA--AKRQTWDSNS-----------------------------------
E7FBJ6_BAD-01           ENT--SHDHQDDS-------------------------------------
B5XEF1_BAD-01           MDY--THDCVDECES-----------------------------------
H3D8J8_BAD-01           SDS--DSEPSEEVEE-----------------------------------
A0A3B5L9R9_BAD-01       SDG--ESDPSEDVEE-----------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B1IH05_BAD-01       -SD--ESDASEELGD-----------------------------------
A0A3Q2QC80_BAD-01       SDS--DSEPPEEVEE-----------------------------------
A0A3Q3MLA0_BAD-02       SDS--ESGSEEEVKE-----------------------------------
A0A3Q3MLA0_BAD-03       SDS--ESGSEEEVKE-----------------------------------
I3K7B6_BAD-01           SDS--ESETSEEVGE-----------------------------------
A0A3P9B2E4_BAD-01       SDS--DSEASEEVGE-----------------------------------
A0A3Q3C680_BAD-01       SDS--DSEASEEVGE-----------------------------------
A0A3P8QRJ7_BAD-01       SDS--DSEASEEVGE-----------------------------------
A0A3Q4GGN3_BAD-01       SDS--DSETSEEVGE-----------------------------------
A0A3B4GXJ6_BAD-01       SDS--DSEASEEVGE-----------------------------------
A0A3Q2D5S0_BAD-01       SDS--DTEPSEEVEE-----------------------------------
A0A3B3BQF7_BAD-01       SDN--DSESSEEVEG-----------------------------------
A0A3Q1K1C7_BAD-02       SDS--DSDPSEGMEE-----------------------------------
A0A3Q1K1C7_BAD-01       SDS--DSDPSEGMEE-----------------------------------
A0A3Q1GWH9_BAD-01       SDG--DSEPEE--VE-----------------------------------
A0A3Q1CPU7_BAD-01       SDS--ESEPSEEVEE-----------------------------------
A0A3P8TWH6_BAD-01       SDS--ESEPSEEVEE-----------------------------------
A0A2U9BAC9_BAD-01       SDS--ESEPSEEVEE-----------------------------------
A0A3B4VFC5_BAD-01       SDS--ESEPSEEVDE-----------------------------------
A0A3B4W9T1_BAD-01       SDS--ESEPSEEVDE-----------------------------------
A0A3Q0QNQ2_BAD-01       IQG--RGQQPSHL-------------------------------------
A0A3P8WIZ8_BAD-02       SDS--ESEPEEEVEG-----------------------------------
A0A3P8WIZ8_BAD-01       SDS--ESEPEEEVEG-----------------------------------
A0A3P9A5G8_BAD-02       QDC--VGDIPENINE-----------------------------------
A0A3P9A5G8_BAD-01       QDC--VGDIPENINE-----------------------------------
B5X1T1_BAD-01           HDC--VDDNPETMNE-----------------------------------
H3ANP3_BAD-03           SDS--DSDAYEDDRT-----------------------------------
H3ANP3_BAD-04           SDS--DSDAYEDDRT-----------------------------------
H3ANP3_BAD-02           SDS--DSDAYEDDRT-----------------------------------
H3ANP3_BAD-01           SDS--DSDAYEDDRT-----------------------------------
A0A3B3QX41_BAD-01       GNE--SDTSESDTPD-----------------------------------
Q4V925_BAD-02           DDS--ETETMEDSED-----------------------------------
Q4V925_BAD-03           DDS--ETETMEDSED-----------------------------------
A7MCM4_BAD-01           DDS--ETETMEDSEA-----------------------------------
Q4V925_BAD-04           DDS--ETETMEDSED-----------------------------------
Q4V925_BAD-01           DDS--ETETMEDSED-----------------------------------
A0A3P8Y761_BAD-01       SDT--ESESSDVEET-----------------------------------
A0A3B5K831_BAD-01       SDS--DSDPSEEVDE-----------------------------------
A0A3B5Q2N7_BAD-01       SDG--ESDPSEDVEE-----------------------------------
A0A087X8P8_BAD-01       SDS--DSEPSEDVEE-----------------------------------
A0A3B3UA11_BAD-01       SDS--DSEPSEDVEE-----------------------------------
A0A3B3YFR1_BAD-01       SDS--DSEPSEDVEE-----------------------------------
A0A3P9Q7C3_BAD-01       SDS--DSEPSEDVEE-----------------------------------
A0A3B3HDU2_BAD-01       SD---DSESSEEVEG-----------------------------------
A0A3B5BAL2_BAD-01       SGS--ESDP-EEVEE-----------------------------------
A0A3Q3AEL8_BAD-02       SDS--ESEPSDEVEE-----------------------------------
A0A3Q3AEL8_BAD-01       SDS--ESEPSDEVEE-----------------------------------
G3Q8B3_BAD-01           SDS--ESEPSDGVEE-----------------------------------
A0A3Q2Y0E4_BAD-01       SDS--ESEPSEEVEE-----------------------------------
A0A3Q3R5S3_BAD-01       SDS--ESESSEEVEE-----------------------------------
A0A3Q3RXS8_BAD-02       SES--ESDSSEEVEG-----------------------------------
A0A3Q3RXS8_BAD-01       SES--ESDSSEEVEG-----------------------------------
A0A3Q0QNQ2_BAD-02       PEP--PRLVLFDVEE-----------------------------------
A0A3Q3WTY4_BAD-01       SDS--ESELSEEIEE-----------------------------------
A0A3B1JXK6_BCL2L11      -MS--RPSNRATRPPFLKEQ-----------------------GERGQSG
A0A3B4BVX1_BCL2L11      PHY--LRSNRAGRPAFLKEQ-----------------------GESGQSS
A0A3B4BVX1_BCL2L11      --------MQNSNYCCF--EQGESGQSSG------AASSRA--AEQCE--
A0A3B4BVX1_BCL2L11      --M--SRRSNRAGRPAFLKEQGESGQSSG------AASSRA--AEQCE--
A0A3P8XIA2_BCL2L11      DSS--RPQNRSNGTTTLIGRGKIGESHPCGGATSSSKLSDY--PQSC---
A0A3Q1ICY2_BCL2L11      MDP--RQPNRSDGSTAVTATGESGGDPPPVGAAGVSTPTSR--SNDGG--
A0A3Q3K6I5_BCL2L11      HLS--RPPNRSDGSTAVTATEES-GDPPSVGAAGTSAQSSR--SNGGS--
A0A3B4V919_BCL2L11      QTT--KPVRWLDRSNG-KRGERRGSTTRR--CRWSPSAKPQ--FER----
A0A3B4XZH1_BCL2L11      QTT--KPVRWLDRSNG-KRGERRGSTTRR--CRWSPGAKPQ--FER----
A0A3Q3ESW6_BCL2L11      RPS--RPPNRLDGSPTVTESHGTRGDPPQ--TSRS---------DNSG--
A0A3Q2SZH6_BCL2L11      SSN--RPPNLRDGSTEVTPPEGTGGDPAS--SARTPRLSKH--REGSC--
A0A3B3VNE0_BCL2L11      HSS--RPPNLLDGSTEVTPAEGTGGDPAS--SARTPRSSKH--TERSC--
A0A3B3YII5_BCL2L11      HSL--RPPNLLDGSTEVTPAEGTGGDPAS--SARTPRSSKH--TERSC--
A0A3B3YII5_BCL2L11      HSL--RPPNLLDGSTEVTPAEGTGGDPAS--SARTPRSSKH--TERSC--
A0A3P9N073_BCL2L11      -------------------------DPAS--SARTPRSSKH--TERSC--
A0A3Q3B113_BCL2L11      SPS--RPPNLRDGSTEVKATEGSSGGAPP--SAGAARGSAH--ATR----
A0A3B5M375_BCL2L11      SSN--RPPNLLDGSTEVTPAEGTGGDPAS--SARTPRSSKH--TERSR--
A0A3B5QAM1_BCL2L11      HSL--RPPNLLDGSTEVTPAEGTGGDPAS--SARTPRSSKH--TERSR--
A0A3B5QAM1_BCL2L11      SSN--RPPNLLDGSTEVTPAEGTGGDPAS--SARTPRSSKH--TERSR--
A0A2I3HWI8_BBC3-03      -------------------------------------------MKFGM--
A0A2K6FQZ3_BBC3-04      -------------------------------------------MKFGA--
Q9BXH1_BBC3-05          -------------------------------------------MKFGM--
A0A2R9BZA9_BBC3-01      -------------------------------------------MKFGM--
A0A2I3RGH5_BBC3-03      -------------------------------------------MKFGM--
A0A2K5P2T8_BBC3-03      -------------------------------------------IKFGV--
A0A2K5V8J3_BBC3-03      -------------------------------------------IKFGV--
F7FFP6_BBC3-03          -------------------------------------------IKFGV--
A0A2K6ASP2_BBC3-03      -------------------------------------------IKFGV--
A0A2I3N2Z9_BBC3-03      -------------------------------------------IKFGV--
A0A2K6QZU4_BBC3-04      -------------------------------------------IKFGV--
A0A2R8MW85_BBC3-03      -------------------------------------------MKCGV--
A0A2K6STD6_BBC3-02      -------------------------------------------MKCGM--
G3T2N1_BBC3-01          --M--ARARQEGSSPEPVEGLARESPRPFPLGSLVPSAVSCGLCEPGL--
M3Y0R3_BBC3-01          SAM--ARARQEGSSPEPVEGLSRDGPRPFPLSRLVPSAVSCGLWESDC--
Q99ML1_BBC3-02          --M--ARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGL--
Q80ZG6_BBC3-01          --M--ARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCGLCEPGL--
H0XQ00_BBC3-01          --M--ARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGL--
A0A3Q2GWE8_BBC3-01      --M--ARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGL--
A0A3Q1LXZ6_BBC3-01      --M--ARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGL--
A0A452E3G1_BBC3-01      --M--ARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGL--
J9NTK9_BBC3-01          --M--ARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGL--
A0A337SQV0_BBC3-02      --M--ARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGL--
F1RM01_BBC3-01          --M--ARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGL--
A0A2K6FQZ3_BBC3-01      --M--ARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGL--
Q9BXH1_BBC3-06          --M--ARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGL--
A0A2I3RGH5_BBC3-01      --M--ARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGL--
H2NZD3_BBC3-01          --M--ARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGL--
A0A2K6QZU4_BBC3-01      --M--ARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGL--
A0A0D9S2H2_BBC3-01      SAM--ARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGL--
B4DQK3_BBC3-01          SAM--ARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGL--
A0A3Q3MLA0_BAD-01       SDS--ESGSEEEVKE----------------------------EEN----
G1SS60_BAD-01           --------------------------------------------------
K7E5Y2_BBC3-02          GRL--MPSAV-SCSL----------------------------CEAGL--
A0A3B4DUY7_BAD-01       EEE--RYKKVIKTLT----------------------------GEKGTPF
A0A337SAW2_BAD-01       PEF--EPSEQEDSSP----------------------------TDRGL--
A0A2I3TBK7_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2R8Z697_BAD-02       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2I2Z8C7_BAD-03       PEF--EPSEQEDSSS----------------------------AERGL--
Q92934_BAD-03           PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K5M0C1_BAD-02       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K5XJR2_BAD-02       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2I3MCN5_BAD-03       PEF--EPSEQEDSRS----------------------------AERGL--
A0A2K5VCD8_BAD-02       PEF--EPSEQEDSSS----------------------------AERGL--
F7GVS7_BAD-02           PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K6E7J3_BAD-02       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K5E6K7_BAD-02       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K6TG62_BAD-02       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K5E6K7_BAD-03       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K5HKW9_BAD-02       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K6N1A1_BAD-02       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K6PUM5_BAD-02       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K5M0C1_BAD-03       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K5VCD8_BAD-03       PEF--EPSEQEDSSS----------------------------AERGL--
F7GVS7_BAD-03           PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K5XJR2_BAD-03       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2I3MCN5_BAD-02       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K6E7J3_BAD-03       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2I2Z8C7_BAD-04       PEF--EPSEQEDSSS----------------------------AERGL--
Q92934_BAD-04           PEF--EPSEQEDSSS----------------------------AERGL--
A0A2I3TBK7_BAD-03       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2R8Z697_BAD-03       PEF--EPSEQEDSSS----------------------------AERGL--
F6SJL0_BAD-02           PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K6TG62_BAD-03       PEF--EPSEQEDSSS----------------------------AERGL--
G3VRY4_BAD-02           SEF--EPSEPGEDPS----------------------------ASTAP--
G3VRY4_BAD-01           SEF--EPSEPGEDPS----------------------------ASTAP--
G1P8C5_BAD-01           PEF--EHSEQEDSSP----------------------------ADRGL--
A0A452ER54_BAD-02       PEF--EQSEQEDSSP----------------------------ADRGL--
W5P8G9_BAD-01           PEF--EQSEQEDSSP----------------------------ADRGL--
G3TP47_BAD-01           PEF--EQSDREDSTP----------------------------ADRGL--
G1MI17_BAD-01           PEF--EPSEQEDSSP----------------------------ADRGL--
A0A287AEF3_BAD-01       PEF--EQSEQEDSSP----------------------------ADRGL--
M3YNE7_BAD-01           PEF--EPSEQEDSSP----------------------------ADRGL--
A0A452RJM6_BAD-01       PEF--EPSEQEDSSP----------------------------ADRGL--
A0A384DJL2_BAD-01       PEF--EPSEQEDSSP----------------------------ADRGL--
A0A452ER54_BAD-01       PEF--EQSEQEDSSP----------------------------ADRGL--
F1MUT9_BAD-01           PEF--EQSEQEDSSP----------------------------ADRGL--
Q3SYZ0_BAD-01           PEF--EQSEQEDSSR----------------------------ADRGL--
F7DN67_BAD-01           PEF--EQSEPEDSSP----------------------------ADRGL--
O35147_BAD-01           PEF--EPSEQEDAST----------------------------TDRGL--
H0WVR2_BAD-01           PEF--EPSEQEDSSS----------------------------SDRGL--
H0V608_BAD-01           PEF--EPSEQEDSSS----------------------------EERGL--
A0A2K5E6K7_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K6TG62_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
A0A0D9R491_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K5M0C1_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K5VCD8_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
F7GVS7_BAD-01           PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K6E7J3_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K5XJR2_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2I3MCN5_BAD-04       PEF--EPSEQEDSRS----------------------------AERGL--
A0A2K6N1A1_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K6PUM5_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K5HKW9_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
B4DZQ9_BAD-01           PEF--EPSEQEDSSS----------------------------AERGL--
A0A2K6GWV0_BAD-01       PEF--EPSEQEDSSS----------------------------AGRGL--
F6SJL0_BAD-01           PEF--EPSEQEDSSS----------------------------AERGL--
A0A2I3MCN5_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2I2Z8C7_BAD-02       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2I2Z8C7_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
Q92934_BAD-01           PEF--EPSEQEDSSS----------------------------AERGL--
Q92934_BAD-02           PEF--EPSEQEDSSS----------------------------AERGL--
A0A2I3TBK7_BAD-02       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2R8Z697_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
A0A2J8TYJ3_BAD-01       PEF--EPSEQEDSSS----------------------------AERGL--
F1PK10_BAD-01           PEF--EPSEQEDSSP----------------------------ANRGL--
Q45KI9_BAD-01           PEF--EPSEQEDSSP----------------------------ANRGL--
I3MBM5_BAD-01           PEF--EPSEQEDSSS----------------------------AEGGL--
I3MBM5_BAD-02           PEF--EPSEQEDSSS----------------------------AEGGL--
Q61337_BAD-05           PEF--EPSEQEDASA----------------------------TDRGL--
Q61337_BAD-04           PEF--EPSEQEDASA----------------------------TDRGL--
Q61337_BAD-03           PEF--EPSEQEDASA----------------------------TDRGL--
Q61337_BAD-06           PEF--EPSEQEDASA----------------------------TDRGL--
Q61337_BAD-02           PEF--EPSEQEDASA----------------------------TDRGL--
Q61337_BAD-01           PEF--EPSEQEDASA----------------------------TDRGL--
I3LVX0_BIK-01           DEMDLCFQDL---QL-----------------------------------
A0A3G3M2M0_BCL2L11      AGVGAALRPGHFDFP-----------------------------------
A0A3Q1ELG4_BCL2L11      EPVGAAGVSAKTSRS-----------------------------------
A0A3Q1CI15_BCL2L11      ERL----------PP-----------------------------------
O61667_EGL1-01          NMFYSSSQDF----------------------------------------
Q9BXH1_BBC3-03          QIC--GPRER---HG-----------------------------------
F6TGJ4_BMF-01           DVF--YPD-----EF-----------------------------------
A0A452H3N6_BMF-01       DVF--HSDFG---LT-----------------------------------
G1PAU1_BMF-01           DVF--QPED----EL-----------------------------------
A2AV74_BMF-02           DVF--QSEDG---EP-----------------------------------
A0A286XXB0_BMF-03       DVF--QPEDG---EP-----------------------------------
I3MDS9_BMF-02           DVF--QPEDG---EP-----------------------------------
A0A287AIU8_BMF-05       DVF--QPEEG---EP-----------------------------------
A0A287AIU8_BMF-04       DVF--QPEEG---EP-----------------------------------
A0A287AIU8_BMF-03       DVF--QPEEG---EP-----------------------------------
A0A287AIU8_BMF-01       DVF--QPEEG---EP-----------------------------------
A0A287AIU8_BMF-02       DVF--QPEEG---EP-----------------------------------
A0A2K5KGR6_BMF-01       DVF--QPEDG---EP-----------------------------------
A0A2K6FFR1_BMF-02       DVF--QPEDG---ES-----------------------------------
M3WRS0_BMF-02           DVF--QPEDV---EP-----------------------------------
A0A2K5E1W9_BMF-02       DVF--QSEDG---EP-----------------------------------
F7HPK0_BMF-02           DVF--QPEDG---EP-----------------------------------
A0A2K6TW86_BMF-03       DVF--QPEDG---EP-----------------------------------
A0A2K6RAW8_BMF-02       DVF--QPEDG---EP-----------------------------------
G3QIN5_BMF-02           DVF--QPEDG---EP-----------------------------------
Q96LC9_BMF-07           DVF--QPEDG---EP-----------------------------------
Q96LC9_BMF-05           DVF--QPEDG---EP-----------------------------------
A0A2R9BS98_BMF-02       DVF--QPEDG---EP-----------------------------------
A0A2J8QDD5_BMF-01       DVF--QPEDG---EP-----------------------------------
A0A2K5MJY6_BMF-01       DVF--QPEDG---EP-----------------------------------
G7PAW6_BMF-01           DVF--QPEDG---EP-----------------------------------
A0A2K6B5G4_BMF-03       DVF--QPEDG---EP-----------------------------------
A0A2K5Z4C3_BMF-02       DVF--QPEDG---EP-----------------------------------
A0A096NTE9_BMF-03       DVF--QPEDG---EP-----------------------------------
A0A2I3HD83_BMF-01       DVF--QPEDG---EP-----------------------------------
A2AV74_BMF-01           DVF--QSEDG---EP-----------------------------------
Q8K589_BMF-01           DVF--QPEDG---EP-----------------------------------
I3MDS9_BMF-01           DVF--QPEDG---EP-----------------------------------
G3T7Z4_BMF-01           DVF--QPEEG---EP-----------------------------------
F6X3N6_BMF-01           DVF--HPEDS---EP-----------------------------------
G3WDQ2_BMF-01           DVF--HPEDS---EP-----------------------------------
Q96LC9_BMF-06           DVF--QPEDG---EP-----------------------------------
F6TJI0_BMF-02           DVF--QPEDG---EP-----------------------------------
F6TJI0_BMF-01           DVF--QPEDG---EP-----------------------------------
A0A286XXB0_BMF-02       DVF--QPEDG---EP-----------------------------------
J9PB65_BMF-01           DVF--QPEDG---EP-----------------------------------
A0A286XXB0_BMF-01       DVF--QPEDG---EP-----------------------------------
G1SR62_BMF-01           DVF--QPEDG---EP-----------------------------------
W5QFV1_BMF-01           DVF--QPEDG---EP-----------------------------------
Q05KI3_BMF-01           DVF--QPEDG---EP-----------------------------------
Q05KI3_BMF-02           DVF--QPEDG---EP-----------------------------------
A0A452F2E0_BMF-02       DVF--QPEDG---EP-----------------------------------
A0A452F2E0_BMF-01       DVF--QPEDG---EP-----------------------------------
M3WRS0_BMF-01           DVF--QPEDV---EP-----------------------------------
A0A2U4BC98_BMF-01       DVF--QPEDG---EP-----------------------------------
M3YAD5_BMF-01           DVF--QPEDG---EP-----------------------------------
A0A452SED0_BMF-01       DVF--QPEDG---EP-----------------------------------
A0A384D070_BMF-01       DVF--QPEDG---EP-----------------------------------
A0A2K6FFR1_BMF-01       DVF--QPEDG---ES-----------------------------------
H0WYH6_BMF-01           DVF--QPEDG---EL-----------------------------------
A0A096NTE9_BMF-01       DVF--QPEDG---EP-----------------------------------
A0A2K6L933_BMF-02       DVF--QPEDG---EP-----------------------------------
A0A096NTE9_BMF-02       DVF--QPEDG---EP-----------------------------------
A0A2K5MJY6_BMF-02       DVF--QPEDG---EP-----------------------------------
A0A2K5KGR6_BMF-02       DVF--QPEDG---EP-----------------------------------
G7PAW6_BMF-02           DVF--QPEDG---EP-----------------------------------
F7CM09_BMF-02           DVF--QPEDG---EP-----------------------------------
A0A2K6B5G4_BMF-01       DVF--QPEDG---EP-----------------------------------
A0A2K6B5G4_BMF-02       DVF--QPEDG---EP-----------------------------------
A0A2K6B5G4_BMF-04       DVF--QPEDG---EP-----------------------------------
A0A2K5Z4C3_BMF-01       DVF--QPEDG---EP-----------------------------------
A0A2K6L933_BMF-03       DVF--QPEDG---EP-----------------------------------
A0A2K6L933_BMF-01       DVF--QPEDG---EP-----------------------------------
A0A2K6RAW8_BMF-01       DVF--QPEDG---EP-----------------------------------
A0A0D9R4R5_BMF-01       DVF--QPEDG---EP-----------------------------------
F7HPK0_BMF-01           DVF--QPEDG---EP-----------------------------------
A0A2K5E1W9_BMF-01       DVF--QSEDG---EP-----------------------------------
A0A2K6TW86_BMF-02       DVF--QPEDG---EP-----------------------------------
A0A2K6TW86_BMF-01       DVF--QPEDG---EP-----------------------------------
G3QIN5_BMF-01           DVF--QPEDG---EP-----------------------------------
Q96LC9_BMF-01           DVF--QPEDG---EP-----------------------------------
Q96LC9_BMF-04           DVF--QPEDG---EP-----------------------------------
Q96LC9_BMF-03           DVF--QPEDG---EP-----------------------------------
Q96LC9_BMF-02           DVF--QPEDG---EP-----------------------------------
A0A2R9BS98_BMF-01       DVF--QPEDG---EP-----------------------------------
A0A2J8QDD5_BMF-02       DVF--QPEDG---EP-----------------------------------
A0A2J8T301_BMF-01       DVF--QPEDG---EP-----------------------------------
H9GL49_BMF-01           DVF--HAEDC---GL-----------------------------------
K7FRX2_BMF-01           DVF--HSDDF---GL-----------------------------------
A9XRG9_BMF-01           DVF--HSDDF---GL-----------------------------------
A9XRG9_BMF-02           DVF--HSDDF---GL-----------------------------------
U3JS06_BMF-01           DVF--HSDDF---GL-----------------------------------
H0ZMX5_BMF-01           DVF--HSDDF---GL-----------------------------------
A9XRG9_BMF-03           DVF--HSDDF---GL-----------------------------------
A9XRG9_BMF-04           DVF--HSDDF---GL-----------------------------------
G1NHG8_BMF-01           DVF--HSDDF---GL-----------------------------------
A0A3B4UNJ0_BMF-01       DMS--QPI------------------------------------------
B2KKY9_BCL2L11-01       EQT--LAN------------------------------------------
B8JK68_BCL2L11-01       EQT--LAN------------------------------------------
A0A3B4B6Y3_BMF-01       DVF--EPD------------------------------------------
Q0GKC7_BMF-01           DVF--RKG------------------------------------------
A0A3B3RH63_BMF-01       DVF--HTD------------------------------------------
W5N4P7_BMF-01           DVF--HPSH-----------------------------------------
A0A3B1K1X5_BMF-01       DVF--VTD------------------------------------------
A0A3B4CNJ8_BMF-01       DVF--VMD------------------------------------------
A0A2U9CJH3_BMF-01       DVF--EPD------------------------------------------
A0A3Q2YCX7_BMF-01       DVF--EPD------------------------------------------
A0A3Q2YCX7_BMF-02       DVF--EPD------------------------------------------
A0A3P8ZIE7_BMF-01       DVF--EPD------------------------------------------
A0A3Q3QZ16_BMF-01       DVF--EPD------------------------------------------
A0A3Q3QZ16_BMF-02       DVF--EPD------------------------------------------
A0A3Q2PJX9_BMF-02       DVF--EPD------------------------------------------
A0A3Q2PJX9_BMF-03       DVF--EPD------------------------------------------
A0A3Q2PJX9_BMF-01       DVF--EPD------------------------------------------
A0A3B5QK08_BMF-01       DVF--EPD------------------------------------------
A0A3B5QK08_BMF-02       DVF--EPD------------------------------------------
A0A096LRV0_BMF-01       DVF--EPD------------------------------------------
A0A3B3WU80_BMF-01       DVF--EPD------------------------------------------
A0A3P9Q8E2_BMF-01       DVF--EPD------------------------------------------
A0A3Q2E3E8_BMF-02       DVF--EPD------------------------------------------
A0A3Q2E3E8_BMF-01       DVF--EPD------------------------------------------
A0A3Q3GUU5_BMF-01       DVF--EPD------------------------------------------
A0A3B5B8F6_BMF-01       DVF--EPD------------------------------------------
A0A3P8UA78_BMF-01       DVF--EPD------------------------------------------
A0A3P8UA78_BMF-03       DVF--EPD------------------------------------------
A0A3P8UA78_BMF-02       DVF--EPD------------------------------------------
A0A3B3CGR9_BMF-01       DVF--EPD------------------------------------------
A0A3B3I0V9_BMF-04       DVF--EPD------------------------------------------
A0A3B3I0V9_BMF-02       DVF--EPD------------------------------------------
A0A3B3I0V9_BMF-01       DVF--EPD------------------------------------------
A0A3B3I0V9_BMF-03       DVF--EPD------------------------------------------
A0A3P9JM16_BMF-03       DVF--EPD------------------------------------------
A0A3P9JM16_BMF-02       DVF--EPD------------------------------------------
A0A3P9JM16_BMF-01       DVF--EPD------------------------------------------
A0A3Q2ZA20_BMF-01       DVF--EPD------------------------------------------
A0A3P8NFE2_BMF-02       DVF--EPK------------------------------------------
I3K2D6_BMF-01           DVF--EPK------------------------------------------
A0A3P8NFE2_BMF-01       DVF--EPK------------------------------------------
A0A3Q3C5V2_BMF-01       DVF--EPK------------------------------------------
A0A3P9DPJ5_BMF-02       DVF--EPK------------------------------------------
A0A3P9DPJ5_BMF-01       DVF--EPK------------------------------------------
A0A3B4ETH0_BMF-01       DVF--EPK------------------------------------------
A0A3Q4G1I4_BMF-01       DVF--EPK------------------------------------------
A0A3Q1FVH7_BMF-01       DVF--EPD------------------------------------------
A0A3Q1FVH7_BMF-02       DVF--EPD------------------------------------------
A0A3Q1D1K3_BMF-01       DVF--EPD------------------------------------------
A0A3P8RKY9_BMF-01       DVF--EPD------------------------------------------
A0A3Q1IPR4_BMF-01       DVF--EPD------------------------------------------
A0A3B4U5H8_BMF-01       DVF--EPD------------------------------------------
A0A3B4WM88_BMF-01       DVF--EPD------------------------------------------
A0A3Q3LME3_BMF-01       DVF--EPD------------------------------------------
A0A3Q3LME3_BMF-02       DVF--EPD------------------------------------------
A0A3Q3LME3_BMF-03       DVF--EPD------------------------------------------
A0A3Q3VLX6_BMF-01       DVF--EPE------------------------------------------
A0A3B5KWG6_BMF-01       DVF--QPD------------------------------------------
A0A286XF37_PMAIP1-      RAE--LEVEC---AA-----------------------------------
Q9JM54_PMAIP1-01        -----MPGRK---AR-----------------------------------
Q5U777_PMAIP1-01        -----MPGRK---AR-----------------------------------
F1SMU1_PMAIP1-01        CCF--SSSLP---LA-----------------------------------
A0A3B3QC78_BCL2L11      MAESRNPVAE---QT-----------------------------------
A0A3Q2U844_BCL2L11      GRL--PPGEGPGPAV-----------------------------------
G3SU55_BCL2L11-01       GQL--QPAERPPQPP-----------------------------------
G3W979_BCL2L11-01       GQL--QPTERPTQ-P-----------------------------------
A0A2K6KS56_BBC3-02      PGVAGRRRSGPGIGA-----------------------------------
A0A3Q3SYA1_BCL2L11      GTD--QSSVS---PS-----------------------------------
A0A2K5JY52_PMAIP1-      KKARKNAQPS---PA-----------------------------------
A0A096MPU8_PMAIP1-      KKARKNAQPS---PT-----------------------------------
A0A2K5ZWH1_PMAIP1-      KKARKNAQPS---PT-----------------------------------
A0A2K5VPX2_PMAIP1-      KKARKNAQPS---PT-----------------------------------
A0A2K6BV75_PMAIP1-      KKARKNAQPS---PT-----------------------------------
A0A2K6KJF2_PMAIP1-      KKARKNAQPS---PA-----------------------------------
A0A2K6NC45_PMAIP1-      KKARKNAQPS---PA-----------------------------------
Q13794_PMAIP1-02        KKARKNAQPS---PA-----------------------------------
A0A2R9AKC9_PMAIP1-      KKARKNAQPS---PA-----------------------------------
A0A1D5QGJ8_PMAIP1-      KKARKNAQPS---PT-----------------------------------
A0A2I2YVQ5_PMAIP1-      KKARKNAQPS---PA-----------------------------------
A0A2I3SX38_PMAIP1-      KKARKNAQPS---PA-----------------------------------
C1C3S9_BAD-01           -----PPTERGSAFS-----------------------------------
A0A3B4CPH6_BAD-01       HSMNEDALQESGAVR-----------------------------------
F6Z067_BAD-01           QGLPLPFVDPPRGAG-----------------------------------
A0A3Q2LHE3_BIK-01       R----SPEALE-VPG-----------------------------------
A0A452QUG1_BIK-01       HPAGEGAVLTG-AGG-----------------------------------
A0A452V3L2_BIK-01       H----GPEVLE-VPG-----------------------------------
M3XHJ5_BCL2L11-01       KDQ--GTSDVISECG-----------------------------------
W5QCU2_BIK-01           HGP--GFLDDQ-GSG-----------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-01           QVP--QPPVASETPS-----------------------------------
O70337_BIK-02           QVP--QPPVASETPS-----------------------------------
Q925D2_BIK-01           QVP--QPAVVSGAPS-----------------------------------
G1TZR9_BIK-01           QVP--EPLLTAEVPG-----------------------------------
H0W025_BIK-01           PPP--GPLLAEGALG-----------------------------------
A0A2K5CLG5_BIK-01       QFV--HPLTME-VVG-----------------------------------
F7FUT7_BIK-01           QFV--DPLTME-VVG-----------------------------------
A0A2K6TBD7_BIK-01       QFV--DPLTME-VVG-----------------------------------
H2P4N6_BIK-01           QLL--EPPTME-VLG-----------------------------------
G1S1X2_BIK-01           QLL--EPPTME-VLG-----------------------------------
G3QCT2_BIK-01           QLL--EPPTME-VLG-----------------------------------
A0A2R8ZXD2_BIK-01       QLL--EPPTME-VLG-----------------------------------
H2QLU7_BIK-01           QLL--EPPTME-VLG-----------------------------------
Q13323_BIK-01           QLL--EPPTME-VLG-----------------------------------
A0A2K6MCW0_BIK-01       QLL--EPLTME-VLG-----------------------------------
A0A2K6QK74_BIK-01       QLL--EPLTME-VLG-----------------------------------
A0A0D9QZY8_BIK-01       QLL--EPLTME-VLG-----------------------------------
A0A2K5VW94_BIK-01       QLL--EPLTME-VLG-----------------------------------
A0A2K6DBJ4_BIK-01       QLL--EPLTME-VLG-----------------------------------
A0A2K5J4Q7_BIK-01       QLL--EPLTME-VLG-----------------------------------
A0A096NKG5_BIK-01       QLL--EPLTME-VLG-----------------------------------
A0A2K5LDM6_BIK-01       QLL--EPLTME-VLG-----------------------------------
A0A2K5XSA1_BIK-01       QLL--EPLTME-VLG-----------------------------------
F1PUF4_BIK-01           H----GPEVLE-VPG-----------------------------------
H0XAE7_BIK-01           QLL--EPLTME-VLG-----------------------------------
A0A2K6FM79_BIK-01       HLL--DPLILE-VLS-----------------------------------
A0A3P8XIA2_BCL2L11      GIM--MPTNS---LL-----------------------------------
F7G1G0_HRK-01           RG-----------PP-----------------------------------
P62816_HRK-03           RG-----------PP-----------------------------------
P62817_HRK-01           RG-----------PP-----------------------------------
A0A287A5N9_HRK-01       RG-----------PP-----------------------------------
H2NIS8_HRK-01           RG-----------PP-----------------------------------
A0A2K5KZ69_HRK-01       RG-----------PP-----------------------------------
H2Q6Y8_HRK-01           RD-----------PP-----------------------------------
G3UH24_HRK-01           RG-----------PP-----------------------------------
A0A2K5BYA0_HRK-01       RG-----------PP-----------------------------------
U3E722_HRK-01           RG-----------PP-----------------------------------
A0A452DXE5_HRK-01       RG-----------PP-----------------------------------
A0A0D9SC73_HRK-01       RG-----------PP-----------------------------------
A0A3Q2IBL3_HRK-01       RG-----------PP-----------------------------------
A0A337SQ56_HRK-01       RG-----------PP-----------------------------------
G3QTJ6_HRK-01           RG-----------PP-----------------------------------
O00198_HRK-01           RG-----------PP-----------------------------------
A0A1D5R1E4_HRK-01       RG-----------PP-----------------------------------
A0A2K6AYL7_HRK-01       RG-----------PP-----------------------------------
G1QHD8_HRK-01           RG-----------PP-----------------------------------
G1T7W1_HRK-01           RG-----------PP-----------------------------------
H0Y001_HRK-01           RG-----------PP-----------------------------------
A0A096N944_HRK-01       RG-----------PP-----------------------------------
A0A2K6GL98_HRK-01       RG-----------PP-----------------------------------
E2RLD4_HRK-01           RG-----------PP-----------------------------------
F7GVS7_BAD-04           RSR--SA------PP-----------------------------------
Q2PG01_BAD-01           RSR--SA------PP-----------------------------------
A0A2I3H4B2_BAD-01       RSR--SA------PP-----------------------------------
A0A452IFQ4_BAD-01       PAP--PESQRGHTPG-----------------------------------
K7GA86_BCL2L11-01       GQF--QSIERPSQPQ-----------------------------------
A0A3Q2GRS5_BCL2L11      GQL--QPAER---PP-----------------------------------
Q4KMV9_BCL2L11-01       GQL--QSTSRQHSHR-----------------------------------
F7FTC8_BCL2L11-01       GRL--EPAEGPAQPP-----------------------------------
A0A2K6E226_BCL2L11      RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-11       RQL--QPAER---PP-----------------------------------
F7HHA9_BCL2L11-08       RQL--QPAER---PP-----------------------------------
O54918_BCL2L11-06       GQL--QPAER---PP-----------------------------------
O54918_BCL2L11-08       GQL--QPAER---PP-----------------------------------
O54918_BCL2L11-03       GQL--QPAER---PP-----------------------------------
A0A2I3HW02_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6TRZ5_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5HZI7_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5NU92_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5Z8B6_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I2YQ13_BCL2L11      RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-15       RQL--QPAER---PP-----------------------------------
A0A2R9CA99_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2J8JCT2_BCL2L11      RQL--QPAER---PP-----------------------------------
F7HHA9_BCL2L11-07       RQL--QPAER---PP-----------------------------------
A0A2K5CAB2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5X2I7_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I3M6I1_BCL2L11      RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-07       RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-22       RQL--QPAER---PP-----------------------------------
A0A452U4S4_BCL2L11      GQL--QPAER---PP-----------------------------------
C1KGB8_BCL2L11-01       GQL--QPAER---PP-----------------------------------
A0A2K6GE31_BCL2L11      GQL--QSVER---PP-----------------------------------
A0A337SW42_BCL2L11      GQL--QPAER---PP-----------------------------------
O43521_BCL2L11-17       RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-10       RQL--QPAER---PP-----------------------------------
A0A2I2YQ13_BCL2L11      RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-19       RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-13       RQL--QPAER---PP-----------------------------------
A0A2I3HW02_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2R9CA99_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2J8JCT2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5NU92_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5X2I7_BCL2L11      RQL--QPAER---PP-----------------------------------
F7HHA9_BCL2L11-05       RQL--QPAER---PP-----------------------------------
A0A2K5Z8B6_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5HZI7_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6KJP8_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6QIL2_BCL2L11      RQL--QPAER---PP-----------------------------------
O54918_BCL2L11-05       GQL--QPAER---PP-----------------------------------
O88498_BCL2L11-02       GQL--QPAER---PP-----------------------------------
A0A0D9RWE0_BCL2L11      RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-05       RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-25       RQL--QPAER---PP-----------------------------------
F1SU81_BCL2L11-03       GQL--QPAER---PP-----------------------------------
A0A2K6GE31_BCL2L11      GQL--QSVER---PP-----------------------------------
A0A286XJN2_BCL2L11      GQL--QPAER---PS-----------------------------------
A0A2K5CAB2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6TRZ5_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6QIL2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5NU92_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5HZI7_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5X2I7_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6E226_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5Z8B6_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I3M6I1_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I3M6I1_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6KJP8_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I2YQ13_BCL2L11      RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-02       RQL--QPAER---PP-----------------------------------
A0A2R9CA99_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2J8JCT2_BCL2L11      RQL--QPAER---PP-----------------------------------
H2P5E2_BCL2L11-01       RQL--QPAER---PP-----------------------------------
A0A337SW42_BCL2L11      GQL--QPAER---PP-----------------------------------
A0A452SBG5_BCL2L11      GQL--QPAER---PP-----------------------------------
Q2YDF0_BCL2L11-01       GQL--QPAER---PP-----------------------------------
A0A287DFJ0_BCL2L11      GQL--QPAER---PP-----------------------------------
Q2YDF0_BCL2L11-03       GQL--QPAER---PP-----------------------------------
A0A452FCS1_BCL2L11      GQL--QPAER---PP-----------------------------------
A0A2K5CAB2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5Z8B6_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6KJP8_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6QIL2_BCL2L11      RQL--QPAER---PP-----------------------------------
F6XMC1_BCL2L11-09       RQL--QPAER---PP-----------------------------------
A0A2K6TRZ5_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5HZI7_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2R9CA99_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2J8JCT2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5NU92_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5X2I7_BCL2L11      RQL--QPAER---PP-----------------------------------
F7HHA9_BCL2L11-09       RQL--QPAER---PP-----------------------------------
A0A2K6E226_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I3M6I1_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I2YQ13_BCL2L11      RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-06       RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-23       RQL--QPAER---PP-----------------------------------
A0A2I3HW02_BCL2L11      RQL--QPAER---PP-----------------------------------
M3YDI3_BCL2L11-01       GQL--QPVER---PP-----------------------------------
F6XMC1_BCL2L11-02       RQL--QPAER---PP-----------------------------------
F6XMC1_BCL2L11-01       RQL--QPAER---PP-----------------------------------
F7CXT2_BCL2L11-01       GQL--QPTERPTQPQ-----------------------------------
O54918_BCL2L11-01       GQL--QPAER---PP-----------------------------------
O88498_BCL2L11-01       GQL--QPAER---PP-----------------------------------
A0A337SW42_BCL2L11      GQL--QPAER---PP-----------------------------------
A0A337SW42_BCL2L11      GQL--QPAER---PP-----------------------------------
A0A2K5NU92_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5HZI7_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I2YQ13_BCL2L11      RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-24       RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-08       RQL--QPAER---PP-----------------------------------
A0A2K5X2I7_BCL2L11      RQL--QPAER---PP-----------------------------------
F7HHA9_BCL2L11-03       RQL--QPAER---PP-----------------------------------
A0A2K6E226_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5Z8B6_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I3HW02_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2R9CA99_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2J8JCT2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I3M6I1_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6KJP8_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6QIL2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5CAB2_BCL2L11      RQL--QPAER---PP-----------------------------------
F6XMC1_BCL2L11-06       RQL--QPAER---PP-----------------------------------
A0A2K6TRZ5_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5CAB2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6TRZ5_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5CAB2_BCL2L11      RQL--QPAER---PP-----------------------------------
F6XMC1_BCL2L11-04       RQL--QPAER---PP-----------------------------------
A0A2K6TRZ5_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5NU92_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I2YQ13_BCL2L11      RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-18       RQL--QPAER---PP-----------------------------------
A0A2K5X2I7_BCL2L11      RQL--QPAER---PP-----------------------------------
F7HHA9_BCL2L11-01       RQL--QPAER---PP-----------------------------------
A0A2K6E226_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5Z8B6_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I3HW02_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2R9CA99_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2J8JCT2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I3M6I1_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6KJP8_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6QIL2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5NU92_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5HZI7_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I2YQ13_BCL2L11      RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-16       RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-12       RQL--QPAER---PP-----------------------------------
A0A2K5X2I7_BCL2L11      RQL--QPAER---PP-----------------------------------
F7HHA9_BCL2L11-06       RQL--QPAER---PP-----------------------------------
A0A2K6E226_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5Z8B6_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I3HW02_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2R9CA99_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2J8JCT2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I3M6I1_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6KJP8_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6QIL2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5HZI7_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6GE31_BCL2L11      GQL--QSVER---PP-----------------------------------
A0A2K6GE31_BCL2L11      GQL--QSVER---PP-----------------------------------
F6XMC1_BCL2L11-08       RQL--QPAER---PP-----------------------------------
A0A2K6GE31_BCL2L11      GQL--QSVER---PP-----------------------------------
A0A2K6GE31_BCL2L11      GQL--QSVER---PP-----------------------------------
A0A287DFJ0_BCL2L11      GQL--QPAER---PP-----------------------------------
A0A286XJN2_BCL2L11      GQL--QPAER---PS-----------------------------------
A0A286XJN2_BCL2L11      GQL--QPAER---PS-----------------------------------
A0A2K5CAB2_BCL2L11      RQL--QPAER---PP-----------------------------------
F6XMC1_BCL2L11-07       RQL--QPAER---PP-----------------------------------
A0A2K6TRZ5_BCL2L11      RQL--QPAER---PP-----------------------------------
F6XMC1_BCL2L11-05       RQL--QPAER---PP-----------------------------------
A0A2K6TRZ5_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5CAB2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5NU92_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5HZI7_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5X2I7_BCL2L11      RQL--QPAER---PP-----------------------------------
F7HHA9_BCL2L11-02       RQL--QPAER---PP-----------------------------------
A0A2K6E226_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5Z8B6_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I3M6I1_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6KJP8_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6QIL2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I2YQ13_BCL2L11      RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-09       RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-21       RQL--QPAER---PP-----------------------------------
A0A2R9CA99_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2J8JCT2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5NU92_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5HZI7_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5X2I7_BCL2L11      RQL--QPAER---PP-----------------------------------
F7HHA9_BCL2L11-04       RQL--QPAER---PP-----------------------------------
A0A2K6E226_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5Z8B6_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I3M6I1_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6KJP8_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6QIL2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I2YQ13_BCL2L11      RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-20       RQL--QPAER---PP-----------------------------------
A0A2I3HW02_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2R9CA99_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2J8JCT2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5CAB2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5CAB2_BCL2L11      RQL--QPAER---PP-----------------------------------
F6XMC1_BCL2L11-03       RQL--QPAER---PP-----------------------------------
A0A2K6TRZ5_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6TRZ5_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6QIL2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6QIL2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5NU92_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5HZI7_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5X2I7_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6E226_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6E226_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K5Z8B6_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I3M6I1_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6KJP8_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2K6KJP8_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2I2YQ13_BCL2L11      RQL--QPAER---PP-----------------------------------
O43521_BCL2L11-03       RQL--QPAER---PP-----------------------------------
A0A2I3HW02_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2R9CA99_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A2J8JCT2_BCL2L11      RQL--QPAER---PP-----------------------------------
A0A337SW42_BCL2L11      GQL--QPAER---PP-----------------------------------
A0A452FCS1_BCL2L11      GQL--QPAER---PP-----------------------------------
W5PY58_BCL2L11-01       GQL--QPAER---PP-----------------------------------
Q2YDF0_BCL2L11-02       GQL--QPAER---PP-----------------------------------
F1SU81_BCL2L11-02       GQL--QPAER---PP-----------------------------------
G1SSY0_BCL2L11-01       GQL--QPAER---PP-----------------------------------
H0XW23_BCL2L11-01       GQL--QPAER---PP-----------------------------------
A0A337SW42_BCL2L11      GQL--QPAER---PP-----------------------------------
G1LDR8_BCL2L11-01       GQL--QPAER---PP-----------------------------------
J9NWV6_BCL2L11-01       GQL--QPAER---PP-----------------------------------
F1SU81_BCL2L11-01       GQL--QPAER---PP-----------------------------------
                                                                          

A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
K7E5Y2_BBC3-01          TAPQARPRRRVHAPGGLGVGLRSGECAPRLGVRVPCRERGPLSPRCCCRC
A9XRH0_BMF-01           -------------------------------------------MDRPSYL
R4G9R5_BCL2L11-01       --------------------------------------------------
A3KND0_BMF-01           ----------------------------------------MDELDDDVFY
Q6P7C5_BAD-01           ----------------------------------------MGTPKQPSLA
A0A287AEF3_BAD-02       --------------------------------------------------
Q9BXH1_BBC3-04          ----------------------------------------GSAQACPC--
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
A0A3P8RLE2_BCL2L11      ----------------------------------------NLRGGGAD--
A0A3B1JLM2_BAD-01       TLFRPLCWNSS-----------------------------GSTVFTME--
A0A3Q2LHE3_BIK-02       ----------------------------------------GPLVSEPR--
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           ----------------------------------------D------H--
H3D8J8_BAD-01           ----------------------------------------G---------
A0A3B5L9R9_BAD-01       --------------------------------------------------
Q9GL49_PMAIP1-01        -----------------------------------------------M--
A0A3B1IH05_BAD-01       ----------------------------------------S------D--
A0A3Q2QC80_BAD-01       ----------------------------------------E------G--
A0A3Q3MLA0_BAD-02       ----------------------------------------E------E--
A0A3Q3MLA0_BAD-03       ----------------------------------------E------E--
I3K7B6_BAD-01           ----------------------------------------E------E--
A0A3P9B2E4_BAD-01       ----------------------------------------G------E--
A0A3Q3C680_BAD-01       ----------------------------------------E------E--
A0A3P8QRJ7_BAD-01       ----------------------------------------G------E--
A0A3Q4GGN3_BAD-01       ----------------------------------------G------E--
A0A3B4GXJ6_BAD-01       ----------------------------------------G------E--
A0A3Q2D5S0_BAD-01       ----------------------------------------T------R--
A0A3B3BQF7_BAD-01       ----------------------------------------G------R--
A0A3Q1K1C7_BAD-02       ----------------------------------------E------G--
A0A3Q1K1C7_BAD-01       ----------------------------------------E------G--
A0A3Q1GWH9_BAD-01       ----------------------------------------G------E--
A0A3Q1CPU7_BAD-01       ----------------------------------------G------E--
A0A3P8TWH6_BAD-01       ----------------------------------------G------E--
A0A2U9BAC9_BAD-01       ----------------------------------------G------E--
A0A3B4VFC5_BAD-01       ----------------------------------------G------E--
A0A3B4W9T1_BAD-01       ----------------------------------------G------E--
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WIZ8_BAD-02       ----------------------------------------G------K--
A0A3P8WIZ8_BAD-01       ----------------------------------------G------K--
A0A3P9A5G8_BAD-02       ----------------------------------------K------Y--
A0A3P9A5G8_BAD-01       ----------------------------------------K------Y--
B5X1T1_BAD-01           ----------------------------------------H------D--
H3ANP3_BAD-03           ----------------------------------------GPLPLQSG--
H3ANP3_BAD-04           ----------------------------------------GPLPLQSG--
H3ANP3_BAD-02           ----------------------------------------GPLPLQSG--
H3ANP3_BAD-01           ----------------------------------------GPLPLQSG--
A0A3B3QX41_BAD-01       ----------------------------------------V------T--
Q4V925_BAD-02           ----------------------------------------S------S--
Q4V925_BAD-03           ----------------------------------------S------S--
A7MCM4_BAD-01           ----------------------------------------S------S--
Q4V925_BAD-04           ----------------------------------------S------S--
Q4V925_BAD-01           ----------------------------------------S------S--
A0A3P8Y761_BAD-01       ----------------------------------------K------K--
A0A3B5K831_BAD-01       ----------------------------------------G------E--
A0A3B5Q2N7_BAD-01       ----------------------------------------R------G--
A0A087X8P8_BAD-01       ----------------------------------------R------G--
A0A3B3UA11_BAD-01       ----------------------------------------R------G--
A0A3B3YFR1_BAD-01       ----------------------------------------R------G--
A0A3P9Q7C3_BAD-01       ----------------------------------------R------G--
A0A3B3HDU2_BAD-01       ----------------------------------------G------K--
A0A3B5BAL2_BAD-01       ----------------------------------------G------E--
A0A3Q3AEL8_BAD-02       ----------------------------------------G------K--
A0A3Q3AEL8_BAD-01       ----------------------------------------G------K--
G3Q8B3_BAD-01           ----------------------------------------R------E--
A0A3Q2Y0E4_BAD-01       ----------------------------------------G------D--
A0A3Q3R5S3_BAD-01       ----------------------------------------G------K--
A0A3Q3RXS8_BAD-02       ----------------------------------------G------K--
A0A3Q3RXS8_BAD-01       ----------------------------------------G------K--
A0A3Q0QNQ2_BAD-02       ----------------------------------------G------Q--
A0A3Q3WTY4_BAD-01       ----------------------------------------G------E--
A0A3B1JXK6_BCL2L11      GGGGTL----------------------------------SRAEQCEQ--
A0A3B4BVX1_BCL2L11      GAASSR----------------------------------A-AEQCEQ--
A0A3B4BVX1_BCL2L11      ----------------------------------------QPEPGEGD--
A0A3B4BVX1_BCL2L11      ----------------------------------------QPEPGEGD--
A0A3P8XIA2_BCL2L11      -------------------------------------------EGNQQ--
A0A3Q1ICY2_BCL2L11      ----------------------------------------ERRFGRPD--
A0A3Q3K6I5_BCL2L11      ----------------------------------------ERSFGHPG--
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      ----------------------------------------GRNFGRTD--
A0A3Q2SZH6_BCL2L11      ----------------------------------------AQPPGAVT--
A0A3B3VNE0_BCL2L11      ----------------------------------------APQTGAST--
A0A3B3YII5_BCL2L11      ----------------------------------------APQAGAST--
A0A3B3YII5_BCL2L11      ----------------------------------------APQAGAST--
A0A3P9N073_BCL2L11      ----------------------------------------APQAGAST--
A0A3Q3B113_BCL2L11      -----------------------------------------PVRGRAP--
A0A3B5M375_BCL2L11      ----------------------------------------APQAGAST--
A0A3B5QAM1_BCL2L11      ----------------------------------------APQAGAST--
A0A3B5QAM1_BCL2L11      ----------------------------------------APQAGAST--
A0A2I3HWI8_BBC3-03      ----------------------------------------GSARACPC--
A0A2K6FQZ3_BBC3-04      ----------------------------------------GSARACPC--
Q9BXH1_BBC3-05          ----------------------------------------GSAQACPC--
A0A2R9BZA9_BBC3-01      ----------------------------------------GSAQACPC--
A0A2I3RGH5_BBC3-03      ----------------------------------------GSAQACPC--
A0A2K5P2T8_BBC3-03      ----------------------------------------GSARACPC--
A0A2K5V8J3_BBC3-03      ----------------------------------------GSARACPC--
F7FFP6_BBC3-03          ----------------------------------------GSARACPC--
A0A2K6ASP2_BBC3-03      ----------------------------------------GSARACPC--
A0A2I3N2Z9_BBC3-03      ----------------------------------------GSARACPC--
A0A2K6QZU4_BBC3-04      ----------------------------------------GSARACPC--
A0A2R8MW85_BBC3-03      ----------------------------------------GSAWACPC--
A0A2K6STD6_BBC3-02      ----------------------------------------GSAWACPC--
G3T2N1_BBC3-01          ----------------------------------------PRV-AGPR--
M3Y0R3_BBC3-01          ----------------------------------------SPRVAAHG--
Q99ML1_BBC3-02          ----------------------------------------PAAPAAPA--
Q80ZG6_BBC3-01          ----------------------------------------PAAPAAPA--
H0XQ00_BBC3-01          ----------------------------------------PAAPAAPA--
A0A3Q2GWE8_BBC3-01      ----------------------------------------PAAPAAPA--
A0A3Q1LXZ6_BBC3-01      ----------------------------------------PAAPAAPA--
A0A452E3G1_BBC3-01      ----------------------------------------PAAPAAPA--
J9NTK9_BBC3-01          ----------------------------------------PAAPAAPA--
A0A337SQV0_BBC3-02      ----------------------------------------PAAPAAPA--
F1RM01_BBC3-01          ----------------------------------------PAAPAAPT--
A0A2K6FQZ3_BBC3-01      ----------------------------------------PAAPAAPA--
Q9BXH1_BBC3-06          ----------------------------------------AAAPAAPT--
A0A2I3RGH5_BBC3-01      ----------------------------------------AAAPAAPT--
H2NZD3_BBC3-01          ----------------------------------------AAAPAAPA--
A0A2K6QZU4_BBC3-01      ----------------------------------------AATPAAPA--
A0A0D9S2H2_BBC3-01      ----------------------------------------AAAPAAPA--
B4DQK3_BBC3-01          ----------------------------------------AAAPAAPT--
A0A3Q3MLA0_BAD-01       ----------------------------------------DQSSAVEE--
G1SS60_BAD-01           --------------------------------------------------
K7E5Y2_BBC3-02          ----------------------------------------NPSGDSMC--
A0A3B4DUY7_BAD-01       NPLCWNSLRTTACAMEKHSEDGISTMDDQDESNWSETVKNGDSPQLDS--
A0A337SAW2_BAD-01       ----------------------------------------GPSPTGDR--
A0A2I3TBK7_BAD-01       ----------------------------------------GPSPAGDG--
A0A2R8Z697_BAD-02       ----------------------------------------GPSPAGDG--
A0A2I2Z8C7_BAD-03       ----------------------------------------GPSPAGDG--
Q92934_BAD-03           ----------------------------------------GPSPAGDG--
A0A2K5M0C1_BAD-02       ----------------------------------------GPSLAGDR--
A0A2K5XJR2_BAD-02       ----------------------------------------GPSLAGDR--
A0A2I3MCN5_BAD-03       ----------------------------------------GPSPAGDK--
A0A2K5VCD8_BAD-02       ----------------------------------------GPSPAGDR--
F7GVS7_BAD-02           ----------------------------------------GPSPAGDR--
A0A2K6E7J3_BAD-02       ----------------------------------------GPSPAGDR--
A0A2K5E6K7_BAD-02       ----------------------------------------SPSTAGDR--
A0A2K6TG62_BAD-02       ----------------------------------------SPSTAGDS--
A0A2K5E6K7_BAD-03       ----------------------------------------SPSTAGDR--
A0A2K5HKW9_BAD-02       ----------------------------------------GPSPAGDR--
A0A2K6N1A1_BAD-02       ----------------------------------------GPSPAGDR--
A0A2K6PUM5_BAD-02       ----------------------------------------GPSPAGDR--
A0A2K5M0C1_BAD-03       ----------------------------------------GPSLAGDR--
A0A2K5VCD8_BAD-03       ----------------------------------------GPSPAGDR--
F7GVS7_BAD-03           ----------------------------------------GPSPAGDR--
A0A2K5XJR2_BAD-03       ----------------------------------------GPSLAGDR--
A0A2I3MCN5_BAD-02       ----------------------------------------GPSPAGDK--
A0A2K6E7J3_BAD-03       ----------------------------------------GPSPAGDR--
A0A2I2Z8C7_BAD-04       ----------------------------------------GPSPAGDG--
Q92934_BAD-04           ----------------------------------------GPSPAGDG--
A0A2I3TBK7_BAD-03       ----------------------------------------GPSPAGDG--
A0A2R8Z697_BAD-03       ----------------------------------------GPSPAGDG--
F6SJL0_BAD-02           ----------------------------------------SPSTAGDR--
A0A2K6TG62_BAD-03       ----------------------------------------SPSTAGDS--
G3VRY4_BAD-02           ----------------------------------------SLAPLRPG--
G3VRY4_BAD-01           ----------------------------------------SLAPLRPG--
G1P8C5_BAD-01           ----------------------------------------GPCPTGDQ--
A0A452ER54_BAD-02       ----------------------------------------GPSPTGDR--
W5P8G9_BAD-01           ----------------------------------------GPSPTGDR--
G3TP47_BAD-01           ----------------------------------------GPSPEGYW--
G1MI17_BAD-01           ----------------------------------------GPSPTGDQ--
A0A287AEF3_BAD-01       ----------------------------------------GPSPTGTD--
M3YNE7_BAD-01           ----------------------------------------GPSPTGDQ--
A0A452RJM6_BAD-01       ----------------------------------------GPSPTGDQ--
A0A384DJL2_BAD-01       ----------------------------------------GPSPTGDQ--
A0A452ER54_BAD-01       ----------------------------------------GPSPTGDR--
F1MUT9_BAD-01           ----------------------------------------GPSPTGDR--
Q3SYZ0_BAD-01           ----------------------------------------GPSPTGDR--
F7DN67_BAD-01           ----------------------------------------GPSPTGDW--
O35147_BAD-01           ----------------------------------------GPSLTEDQ--
H0WVR2_BAD-01           ----------------------------------------GPSPSGDQ--
H0V608_BAD-01           ----------------------------------------GPSPTGDE--
A0A2K5E6K7_BAD-01       ----------------------------------------SPSTAGDR--
A0A2K6TG62_BAD-01       ----------------------------------------SPSTAGDS--
A0A0D9R491_BAD-01       ----------------------------------------GPSPAGNR--
A0A2K5M0C1_BAD-01       ----------------------------------------GPSLAGDR--
A0A2K5VCD8_BAD-01       ----------------------------------------GPSPAGDR--
F7GVS7_BAD-01           ----------------------------------------GPSPAGDR--
A0A2K6E7J3_BAD-01       ----------------------------------------GPSPAGDR--
A0A2K5XJR2_BAD-01       ----------------------------------------GPSLAGDR--
A0A2I3MCN5_BAD-04       ----------------------------------------GPSPAGDK--
A0A2K6N1A1_BAD-01       ----------------------------------------GPSPAGDR--
A0A2K6PUM5_BAD-01       ----------------------------------------GPSPAGDR--
A0A2K5HKW9_BAD-01       ----------------------------------------GPSPAGDR--
B4DZQ9_BAD-01           ----------------------------------------GPSPAGDG--
A0A2K6GWV0_BAD-01       ----------------------------------------GPSPSGDR--
F6SJL0_BAD-01           ----------------------------------------SPSTAGDR--
A0A2I3MCN5_BAD-01       ----------------------------------------GPSPAGDK--
A0A2I2Z8C7_BAD-02       ----------------------------------------GPSPAGDG--
A0A2I2Z8C7_BAD-01       ----------------------------------------GPSPAGDG--
Q92934_BAD-01           ----------------------------------------GPSPAGDG--
Q92934_BAD-02           ----------------------------------------GPSPAGDG--
A0A2I3TBK7_BAD-02       ----------------------------------------GPSPAGDG--
A0A2R8Z697_BAD-01       ----------------------------------------GPSPAGDG--
A0A2J8TYJ3_BAD-01       ----------------------------------------GPSPAGDR--
F1PK10_BAD-01           ----------------------------------------GPSPTGDR--
Q45KI9_BAD-01           ----------------------------------------GPSPTGDR--
I3MBM5_BAD-01           ----------------------------------------GPSPAGDR--
I3MBM5_BAD-02           ----------------------------------------GPSPAGDR--
Q61337_BAD-05           ----------------------------------------GPSLTEDQ--
Q61337_BAD-04           ----------------------------------------GPSLTEDQ--
Q61337_BAD-03           ----------------------------------------GPSLTEDQ--
Q61337_BAD-06           ----------------------------------------GPSLTEDQ--
Q61337_BAD-02           ----------------------------------------GPSLTEDQ--
Q61337_BAD-01           ----------------------------------------GPSLTEDQ--
I3LVX0_BIK-01           ----------------------------------------AQLPGMAM--
A0A3G3M2M0_BCL2L11      ----------------------------------------QPSDGDPL--
A0A3Q1ELG4_BCL2L11      ----------------------------------------NSTGGEPD--
A0A3Q1CI15_BCL2L11      ----------------------------------------NPSHGSPD--
O61667_EGL1-01          --------------------------------------------------
Q9BXH1_BBC3-03          ----------------------------------------PRTPGGQLPG
F6TGJ4_BMF-01           ----------------------------------------GYPDQTMTSS
A0A452H3N6_BMF-01       ----------------------------------------G-QPGEMTPP
G1PAU1_BMF-01           ----------------------------------------GTQPGSLPSA
A2AV74_BMF-02           ----------------------------------------GTQPGGLLSA
A0A286XXB0_BMF-03       ----------------------------------------GTQPGSLLSA
I3MDS9_BMF-02           ----------------------------------------GTQPGSLLSA
A0A287AIU8_BMF-05       ----------------------------------------GTQPRR-VSA
A0A287AIU8_BMF-04       ----------------------------------------GTQPRR-VSA
A0A287AIU8_BMF-03       ----------------------------------------GTQPRR-VSA
A0A287AIU8_BMF-01       ----------------------------------------GTQPRR-VSA
A0A287AIU8_BMF-02       ----------------------------------------GTQPRR-VSA
A0A2K5KGR6_BMF-01       ----------------------------------------GAQPGSSLSA
A0A2K6FFR1_BMF-02       ----------------------------------------GTQPGSVLSA
M3WRS0_BMF-02           ----------------------------------------GTQPGSLLSA
A0A2K5E1W9_BMF-02       ----------------------------------------GTQPGSLLSA
F7HPK0_BMF-02           ----------------------------------------GTQPGSLLSA
A0A2K6TW86_BMF-03       ----------------------------------------GTQPGSLLSA
A0A2K6RAW8_BMF-02       ----------------------------------------GAQPGSSLSA
G3QIN5_BMF-02           ----------------------------------------VTQPGSLLSA
Q96LC9_BMF-07           ----------------------------------------VTQPGSLLSA
Q96LC9_BMF-05           ----------------------------------------VTQPGSLLSA
A0A2R9BS98_BMF-02       ----------------------------------------VTQPGSLLSA
A0A2J8QDD5_BMF-01       ----------------------------------------VTQPGSLLSA
A0A2K5MJY6_BMF-01       ----------------------------------------GAQPGSSLSA
G7PAW6_BMF-01           ----------------------------------------GSQPGSSLSA
A0A2K6B5G4_BMF-03       ----------------------------------------GAQPGSSLSA
A0A2K5Z4C3_BMF-02       ----------------------------------------GAQPGSSLSA
A0A096NTE9_BMF-03       ----------------------------------------GAQPGSSLSA
A0A2I3HD83_BMF-01       ----------------------------------------GTQPGSLLSA
A2AV74_BMF-01           ----------------------------------------GTQPGGLLSA
Q8K589_BMF-01           ----------------------------------------GTQPGSLLSA
I3MDS9_BMF-01           ----------------------------------------GTQPGSLLSA
G3T7Z4_BMF-01           ----------------------------------------GTQPGGLLSA
F6X3N6_BMF-01           ----------------------------------------GAQPGGLTSA
G3WDQ2_BMF-01           ----------------------------------------GAQPGGLTSP
Q96LC9_BMF-06           ----------------------------------------VTQPGSLLSA
F6TJI0_BMF-02           ----------------------------------------GTQPRSLLSA
F6TJI0_BMF-01           ----------------------------------------GTQPRSLLSA
A0A286XXB0_BMF-02       ----------------------------------------GTQPGSLLSA
J9PB65_BMF-01           ----------------------------------------GTQPGSLLSA
A0A286XXB0_BMF-01       ----------------------------------------GTQPGSLLSA
G1SR62_BMF-01           ----------------------------------------GTQPQSLLSA
W5QFV1_BMF-01           ----------------------------------------GAQPRRLLSA
Q05KI3_BMF-01           ----------------------------------------GTQPRSLLSA
Q05KI3_BMF-02           ----------------------------------------GTQPRSLLSA
A0A452F2E0_BMF-02       ----------------------------------------GAQPRRLLSA
A0A452F2E0_BMF-01       ----------------------------------------GAQPRRLLSA
M3WRS0_BMF-01           ----------------------------------------GTQPGSLLSA
A0A2U4BC98_BMF-01       ----------------------------------------GTQPGSLLSA
M3YAD5_BMF-01           ----------------------------------------GTQPGSLLSA
A0A452SED0_BMF-01       ----------------------------------------GTQPGSLLSA
A0A384D070_BMF-01       ----------------------------------------GTQPGSLLSA
A0A2K6FFR1_BMF-01       ----------------------------------------GTQPGSVLSA
H0WYH6_BMF-01           ----------------------------------------GT--GNVLSA
A0A096NTE9_BMF-01       ----------------------------------------GAQPGSSLSA
A0A2K6L933_BMF-02       ----------------------------------------GAQPGSSLSA
A0A096NTE9_BMF-02       ----------------------------------------GAQPGSSLSA
A0A2K5MJY6_BMF-02       ----------------------------------------GAQPGSSLSA
A0A2K5KGR6_BMF-02       ----------------------------------------GAQPGSSLSA
G7PAW6_BMF-02           ----------------------------------------GSQPGSSLSA
F7CM09_BMF-02           ----------------------------------------GAQPGSSLSA
A0A2K6B5G4_BMF-01       ----------------------------------------GAQPGSSLSA
A0A2K6B5G4_BMF-02       ----------------------------------------GAQPGSSLSA
A0A2K6B5G4_BMF-04       ----------------------------------------GAQPGSSLSA
A0A2K5Z4C3_BMF-01       ----------------------------------------GAQPGSSLSA
A0A2K6L933_BMF-03       ----------------------------------------GAQPGSSLSA
A0A2K6L933_BMF-01       ----------------------------------------GAQPGSSLSA
A0A2K6RAW8_BMF-01       ----------------------------------------GAQPGSSLSA
A0A0D9R4R5_BMF-01       ----------------------------------------GAQPGSSLSA
F7HPK0_BMF-01           ----------------------------------------GTQPGSLLSA
A0A2K5E1W9_BMF-01       ----------------------------------------GTQPGSLLSA
A0A2K6TW86_BMF-02       ----------------------------------------GTQPGSLLSA
A0A2K6TW86_BMF-01       ----------------------------------------GTQPGSLLSA
G3QIN5_BMF-01           ----------------------------------------VTQPGSLLSA
Q96LC9_BMF-01           ----------------------------------------VTQPGSLLSA
Q96LC9_BMF-04           ----------------------------------------VTQPGSLLSA
Q96LC9_BMF-03           ----------------------------------------VTQPGSLLSA
Q96LC9_BMF-02           ----------------------------------------VTQPGSLLSA
A0A2R9BS98_BMF-01       ----------------------------------------VTQPGSLLSA
A0A2J8QDD5_BMF-02       ----------------------------------------VTQPGSLLSA
A0A2J8T301_BMF-01       ----------------------------------------GTQSGSLLSA
H9GL49_BMF-01           ----------------------------------------ASQPSEMTFP
K7FRX2_BMF-01           ----------------------------------------TGQPGEMTPT
A9XRG9_BMF-01           ----------------------------------------AGQPGEMTAT
A9XRG9_BMF-02           ----------------------------------------AGQPGEMTAT
U3JS06_BMF-01           ----------------------------------------AGQPGEMTAT
H0ZMX5_BMF-01           ----------------------------------------AGQPGEMTAT
A9XRG9_BMF-03           ----------------------------------------AGQPGEMTAT
A9XRG9_BMF-04           ----------------------------------------AGQPGEMTAT
G1NHG8_BMF-01           ----------------------------------------AGQPGEMTAT
A0A3B4UNJ0_BMF-01       --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2E3E8_BMF-02       --------------------------------------------------
A0A3Q2E3E8_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-04       --------------------------------------------------
A0A3B3I0V9_BMF-02       --------------------------------------------------
A0A3B3I0V9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-03       --------------------------------------------------
A0A3P9JM16_BMF-03       --------------------------------------------------
A0A3P9JM16_BMF-02       --------------------------------------------------
A0A3P9JM16_BMF-01       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3LME3_BMF-01       --------------------------------------------------
A0A3Q3LME3_BMF-02       --------------------------------------------------
A0A3Q3LME3_BMF-03       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3B5KWG6_BMF-01       --------------------------------------------------
A0A286XF37_PMAIP1-      ----------------------------------------QLRRVGDT--
Q9JM54_PMAIP1-01        ----------------------------------------RNAPVNPT--
Q5U777_PMAIP1-01        ----------------------------------------RNAPLNPT--
F1SMU1_PMAIP1-01        ----------------------------------------RFCPTAPR--
A0A3B3QC78_BCL2L11      ----------------------------------------PIQAGPRTAK
A0A3Q2U844_BCL2L11      ----------------------------------------PLRPGAPA--
G3SU55_BCL2L11-01       ----------------------------------------QLRPGAPT--
G3W979_BCL2L11-01       ----------------------------------------QLRPGAPT--
A0A2K6KS56_BBC3-02      ----------------------------------------QLRRMAR---
A0A3Q3SYA1_BCL2L11      ----------------------------------------RGRTRSIA--
A0A2K5JY52_PMAIP1-      ----------------------------------------RAQ-AGT-DP
A0A096MPU8_PMAIP1-      ----------------------------------------RAQ-AGQAGT
A0A2K5ZWH1_PMAIP1-      ----------------------------------------RAQ-AGQAGT
A0A2K5VPX2_PMAIP1-      ----------------------------------------RAQ-AGQAGT
A0A2K6BV75_PMAIP1-      ----------------------------------------RAQ-AGPAGT
A0A2K6KJF2_PMAIP1-      ----------------------------------------RAQ-AGPAGT
A0A2K6NC45_PMAIP1-      ----------------------------------------RAQ-AGPAGT
Q13794_PMAIP1-02        ----------------------------------------RAP-AGPAGT
A0A2R9AKC9_PMAIP1-      ----------------------------------------RAP-AGP---
A0A1D5QGJ8_PMAIP1-      ----------------------------------------RAQAAGTAGT
A0A2I2YVQ5_PMAIP1-      ----------------------------------------RAP----AGP
A0A2I3SX38_PMAIP1-      ----------------------------------------RAP----AGP
C1C3S9_BAD-01           ----------------------------------------GTNPPGFG--
A0A3B4CPH6_BAD-01       ----------------------------------------HGDGAADG--
F6Z067_BAD-01           ----------------------------------------VRQP------
A0A3Q2LHE3_BIK-01       ----------------------------------------MTEL------
A0A452QUG1_BIK-01       ----------------------------------------ICQ-------
A0A452V3L2_BIK-01       ----------------------------------------MTDL------
M3XHJ5_BCL2L11-01       ----------------------------------------HLHPTQRP--
W5QCU2_BIK-01           ----------------------------------------LPGVTSIL--
O70337_BIK-04           --------------------------------------------------
O70337_BIK-01           ----------------------------------------MKE-------
O70337_BIK-02           ----------------------------------------MKE-------
Q925D2_BIK-01           ----------------------------------------MKEPVGVE--
G1TZR9_BIK-01           ----------------------------------------LTRPVEEG--
H0W025_BIK-01           ----------------------------------------VTQPLWAE--
A0A2K5CLG5_BIK-01       ----------------------------------------GSDP--EE--
F7FUT7_BIK-01           ----------------------------------------GSDP--EE--
A0A2K6TBD7_BIK-01       ----------------------------------------GSDP--EE--
H2P4N6_BIK-01           ----------------------------------------VTDS--EE--
G1S1X2_BIK-01           ----------------------------------------VTDP--EE--
G3QCT2_BIK-01           ----------------------------------------VTDS--EE--
A0A2R8ZXD2_BIK-01       ----------------------------------------VTES--EE--
H2QLU7_BIK-01           ----------------------------------------VTDS--EE--
Q13323_BIK-01           ----------------------------------------MTDS--EE--
A0A2K6MCW0_BIK-01       ----------------------------------------VTDP--EE--
A0A2K6QK74_BIK-01       ----------------------------------------VTDP--EE--
A0A0D9QZY8_BIK-01       ----------------------------------------VTDP--EE--
A0A2K5VW94_BIK-01       ----------------------------------------VTDP--EE--
A0A2K6DBJ4_BIK-01       ----------------------------------------VTDP--EE--
A0A2K5J4Q7_BIK-01       ----------------------------------------VTDP--EE--
A0A096NKG5_BIK-01       ----------------------------------------VTDP--EE--
A0A2K5LDM6_BIK-01       ----------------------------------------VTDP--EE--
A0A2K5XSA1_BIK-01       ----------------------------------------VTDP--EE--
F1PUF4_BIK-01           ----------------------------------------MTDL--VE--
H0XAE7_BIK-01           ----------------------------------------MTE-------
A0A2K6FM79_BIK-01       ----------------------------------------IMDN--EE--
A0A3P8XIA2_BCL2L11      ----------------------------------------GFQSRSPL--
F7G1G0_HRK-01           ----------------------------------------AVCACSSD--
P62816_HRK-03           ----------------------------------------AVCGCGDA--
P62817_HRK-01           ----------------------------------------AVCGCGDA--
A0A287A5N9_HRK-01       ----------------------------------------AVCACSAS--
H2NIS8_HRK-01           ----------------------------------------AVCACSAG--
A0A2K5KZ69_HRK-01       ----------------------------------------AVCDCSAG--
H2Q6Y8_HRK-01           ----------------------------------------AVCACSAG--
G3UH24_HRK-01           ----------------------------------------AVCACSAG--
A0A2K5BYA0_HRK-01       ----------------------------------------AVCACSAG--
U3E722_HRK-01           ----------------------------------------AVCACSAG--
A0A452DXE5_HRK-01       ----------------------------------------AVCACSAG--
A0A0D9SC73_HRK-01       ----------------------------------------AVCACSAG--
A0A3Q2IBL3_HRK-01       ----------------------------------------AVCACSAG--
A0A337SQ56_HRK-01       ----------------------------------------AVCACSAG--
G3QTJ6_HRK-01           ----------------------------------------AVCACSAG--
O00198_HRK-01           ----------------------------------------AVCACSAG--
A0A1D5R1E4_HRK-01       ----------------------------------------AVCACSAG--
A0A2K6AYL7_HRK-01       ----------------------------------------AVCACSAG--
G1QHD8_HRK-01           ----------------------------------------AVCACSAG--
G1T7W1_HRK-01           ----------------------------------------AVCACSAG--
H0Y001_HRK-01           ----------------------------------------AVCACSAG--
A0A096N944_HRK-01       ----------------------------------------AVCACSAG--
A0A2K6GL98_HRK-01       ----------------------------------------AVCACSAG--
E2RLD4_HRK-01           ----------------------------------------AVCACSAG--
F7GVS7_BAD-04           ----------------------------------------NLWAAQRY--
Q2PG01_BAD-01           ----------------------------------------NLWAAQRY--
A0A2I3H4B2_BAD-01       ----------------------------------------NLWAAQRY--
A0A452IFQ4_BAD-01       ----------------------------------------SKQPDTPTAE
K7GA86_BCL2L11-01       ----------------------------------------HLRPGAPT--
A0A3Q2GRS5_BCL2L11      ----------------------------------------QLRPGAPT--
Q4KMV9_BCL2L11-01       ----------------------------------------PLRRGAPT--
F7FTC8_BCL2L11-01       ----------------------------------------QLRPGAPT--
A0A2K6E226_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-11       ----------------------------------------QLRPGAPT--
F7HHA9_BCL2L11-08       ----------------------------------------QLRPGAPT--
O54918_BCL2L11-06       ----------------------------------------QLRPGAPT--
O54918_BCL2L11-08       ----------------------------------------QLRPGAPT--
O54918_BCL2L11-03       ----------------------------------------QLRPGAPT--
A0A2I3HW02_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6TRZ5_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5HZI7_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5NU92_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5Z8B6_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I2YQ13_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-15       ----------------------------------------QLRPGAPT--
A0A2R9CA99_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2J8JCT2_BCL2L11      ----------------------------------------QLRPGAPT--
F7HHA9_BCL2L11-07       ----------------------------------------QLRPGAPT--
A0A2K5CAB2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5X2I7_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I3M6I1_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-07       ----------------------------------------QLRPGAPT--
O43521_BCL2L11-22       ----------------------------------------QLRPGAPT--
A0A452U4S4_BCL2L11      ----------------------------------------QLRPGAPT--
C1KGB8_BCL2L11-01       ----------------------------------------QLRPGAPT--
A0A2K6GE31_BCL2L11      ----------------------------------------QLRPGAPT--
A0A337SW42_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-17       ----------------------------------------QLRPGAPT--
O43521_BCL2L11-10       ----------------------------------------QLRPGAPT--
A0A2I2YQ13_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-19       ----------------------------------------QLRPGAPT--
O43521_BCL2L11-13       ----------------------------------------QLRPGAPT--
A0A2I3HW02_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2R9CA99_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2J8JCT2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5NU92_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5X2I7_BCL2L11      ----------------------------------------QLRPGAPT--
F7HHA9_BCL2L11-05       ----------------------------------------QLRPGAPT--
A0A2K5Z8B6_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5HZI7_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6KJP8_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6QIL2_BCL2L11      ----------------------------------------QLRPGAPT--
O54918_BCL2L11-05       ----------------------------------------QLRPGAPT--
O88498_BCL2L11-02       ----------------------------------------QLRPGAPT--
A0A0D9RWE0_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-05       ----------------------------------------QLRPGAPT--
O43521_BCL2L11-25       ----------------------------------------QLRPGAPT--
F1SU81_BCL2L11-03       ----------------------------------------QLRPGAPT--
A0A2K6GE31_BCL2L11      ----------------------------------------QLRPGAPT--
A0A286XJN2_BCL2L11      ----------------------------------------QLRAGAPT--
A0A2K5CAB2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6TRZ5_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6QIL2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5NU92_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5HZI7_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5X2I7_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6E226_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5Z8B6_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I3M6I1_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I3M6I1_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6KJP8_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I2YQ13_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-02       ----------------------------------------QLRPGAPT--
A0A2R9CA99_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2J8JCT2_BCL2L11      ----------------------------------------QLRPGAPT--
H2P5E2_BCL2L11-01       ----------------------------------------QLRPGAPT--
A0A337SW42_BCL2L11      ----------------------------------------QLRPGAPT--
A0A452SBG5_BCL2L11      ----------------------------------------QLRPGAPT--
Q2YDF0_BCL2L11-01       ----------------------------------------QLRPGAPT--
A0A287DFJ0_BCL2L11      ----------------------------------------QLRPGAPT--
Q2YDF0_BCL2L11-03       ----------------------------------------QLRPGAPT--
A0A452FCS1_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5CAB2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5Z8B6_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6KJP8_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6QIL2_BCL2L11      ----------------------------------------QLRPGAPT--
F6XMC1_BCL2L11-09       ----------------------------------------QLRPGAPT--
A0A2K6TRZ5_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5HZI7_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2R9CA99_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2J8JCT2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5NU92_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5X2I7_BCL2L11      ----------------------------------------QLRPGAPT--
F7HHA9_BCL2L11-09       ----------------------------------------QLRPGAPT--
A0A2K6E226_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I3M6I1_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I2YQ13_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-06       ----------------------------------------QLRPGAPT--
O43521_BCL2L11-23       ----------------------------------------QLRPGAPT--
A0A2I3HW02_BCL2L11      ----------------------------------------QLRPGAPT--
M3YDI3_BCL2L11-01       ----------------------------------------QLRPGAPT--
F6XMC1_BCL2L11-02       ----------------------------------------QLRPGAPT--
F6XMC1_BCL2L11-01       ----------------------------------------QLRPGAPT--
F7CXT2_BCL2L11-01       ----------------------------------------QLRPGAPT--
O54918_BCL2L11-01       ----------------------------------------QLRPGAPT--
O88498_BCL2L11-01       ----------------------------------------QLRPGAPT--
A0A337SW42_BCL2L11      ----------------------------------------QLRPGAPT--
A0A337SW42_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5NU92_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5HZI7_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I2YQ13_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-24       ----------------------------------------QLRPGAPT--
O43521_BCL2L11-08       ----------------------------------------QLRPGAPT--
A0A2K5X2I7_BCL2L11      ----------------------------------------QLRPGAPT--
F7HHA9_BCL2L11-03       ----------------------------------------QLRPGAPT--
A0A2K6E226_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5Z8B6_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I3HW02_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2R9CA99_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2J8JCT2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I3M6I1_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6KJP8_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6QIL2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5CAB2_BCL2L11      ----------------------------------------QLRPGAPT--
F6XMC1_BCL2L11-06       ----------------------------------------QLRPGAPT--
A0A2K6TRZ5_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5CAB2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6TRZ5_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5CAB2_BCL2L11      ----------------------------------------QLRPGAPT--
F6XMC1_BCL2L11-04       ----------------------------------------QLRPGAPT--
A0A2K6TRZ5_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5NU92_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I2YQ13_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-18       ----------------------------------------QLRPGAPT--
A0A2K5X2I7_BCL2L11      ----------------------------------------QLRPGAPT--
F7HHA9_BCL2L11-01       ----------------------------------------QLRPGAPT--
A0A2K6E226_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5Z8B6_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I3HW02_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2R9CA99_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2J8JCT2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I3M6I1_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6KJP8_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6QIL2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5NU92_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5HZI7_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I2YQ13_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-16       ----------------------------------------QLRPGAPT--
O43521_BCL2L11-12       ----------------------------------------QLRPGAPT--
A0A2K5X2I7_BCL2L11      ----------------------------------------QLRPGAPT--
F7HHA9_BCL2L11-06       ----------------------------------------QLRPGAPT--
A0A2K6E226_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5Z8B6_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I3HW02_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2R9CA99_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2J8JCT2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I3M6I1_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6KJP8_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6QIL2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5HZI7_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6GE31_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6GE31_BCL2L11      ----------------------------------------QLRPGAPT--
F6XMC1_BCL2L11-08       ----------------------------------------QLRPGAPT--
A0A2K6GE31_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6GE31_BCL2L11      ----------------------------------------QLRPGAPT--
A0A287DFJ0_BCL2L11      ----------------------------------------QLRPGAPT--
A0A286XJN2_BCL2L11      ----------------------------------------QLRAGAPT--
A0A286XJN2_BCL2L11      ----------------------------------------QLRAGAPT--
A0A2K5CAB2_BCL2L11      ----------------------------------------QLRPGAPT--
F6XMC1_BCL2L11-07       ----------------------------------------QLRPGAPT--
A0A2K6TRZ5_BCL2L11      ----------------------------------------QLRPGAPT--
F6XMC1_BCL2L11-05       ----------------------------------------QLRPGAPT--
A0A2K6TRZ5_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5CAB2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5NU92_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5HZI7_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5X2I7_BCL2L11      ----------------------------------------QLRPGAPT--
F7HHA9_BCL2L11-02       ----------------------------------------QLRPGAPT--
A0A2K6E226_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5Z8B6_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I3M6I1_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6KJP8_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6QIL2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I2YQ13_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-09       ----------------------------------------QLRPGAPT--
O43521_BCL2L11-21       ----------------------------------------QLRPGAPT--
A0A2R9CA99_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2J8JCT2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5NU92_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5HZI7_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5X2I7_BCL2L11      ----------------------------------------QLRPGAPT--
F7HHA9_BCL2L11-04       ----------------------------------------QLRPGAPT--
A0A2K6E226_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5Z8B6_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I3M6I1_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6KJP8_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6QIL2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I2YQ13_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-20       ----------------------------------------QLRPGAPT--
A0A2I3HW02_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2R9CA99_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2J8JCT2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5CAB2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5CAB2_BCL2L11      ----------------------------------------QLRPGAPT--
F6XMC1_BCL2L11-03       ----------------------------------------QLRPGAPT--
A0A2K6TRZ5_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6TRZ5_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6QIL2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6QIL2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5NU92_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5HZI7_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5X2I7_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6E226_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6E226_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K5Z8B6_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I3M6I1_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6KJP8_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2K6KJP8_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2I2YQ13_BCL2L11      ----------------------------------------QLRPGAPT--
O43521_BCL2L11-03       ----------------------------------------QLRPGAPT--
A0A2I3HW02_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2R9CA99_BCL2L11      ----------------------------------------QLRPGAPT--
A0A2J8JCT2_BCL2L11      ----------------------------------------QLRPGAPT--
A0A337SW42_BCL2L11      ----------------------------------------QLRPGAPT--
A0A452FCS1_BCL2L11      ----------------------------------------QLRPGAPT--
W5PY58_BCL2L11-01       ----------------------------------------QLRPGAPT--
Q2YDF0_BCL2L11-02       ----------------------------------------QLRPGAPT--
F1SU81_BCL2L11-02       ----------------------------------------QLRPGAPT--
G1SSY0_BCL2L11-01       ----------------------------------------QLRPGAPT--
H0XW23_BCL2L11-01       ----------------------------------------QLRPGAPT--
A0A337SW42_BCL2L11      ----------------------------------------QLRPGAPT--
G1LDR8_BCL2L11-01       ----------------------------------------QLRPGAPT--
J9NWV6_BCL2L11-01       ----------------------------------------QLRPGAPT--
F1SU81_BCL2L11-01       ----------------------------------------QLRPGAPT--
                                                                          

A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
K7E5Y2_BBC3-01          ECGAGLGKLRRGRARGVAPPLTCSAHLSVSLRRLPPHWGMARAQQDGSSP
A9XRH0_BMF-01           EEDYSSLDGLDDD-------------------VFHSDD--------FGLA
R4G9R5_BCL2L11-01       ---MLVVGSSQPQLCLLPKQLNVLSANAFAISCFLYRDVP------WRRT
A3KND0_BMF-01           PD------------------------------AFGYPDQTITSSSLFNQS
Q6P7C5_BAD-01           PAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPE--------FEPS
A0A287AEF3_BAD-02       --------------------------------MFQIPE--------FEQS
Q9BXH1_BBC3-04          --------------------------------------QVPRAA------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------PEPVGA------
A0A3B1JLM2_BAD-01       --------------------------------------KTPPHSKEDDIS
A0A3Q2LHE3_BIK-02       --------------------------------------S-----------
E7FBJ6_BAD-01           ----------------------------------------STLDEKERSH
B5XEF1_BAD-01           --------------------------------------SGTTRNSEFQLH
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------RSSGSLGSRIRG
A0A3B1IH05_BAD-01       --------------------------------------QPEVSKTAE---
A0A3Q2QC80_BAD-01       --------------------------------------NDQPADGKV---
A0A3Q3MLA0_BAD-02       --------------------------------------NDQSSAVEE---
A0A3Q3MLA0_BAD-03       --------------------------------------NDQSSAVEE---
I3K7B6_BAD-01           --------------------------------------NQQPAGQDQ---
A0A3P9B2E4_BAD-01       --------------------------------------NQQSAGQAQ---
A0A3Q3C680_BAD-01       --------------------------------------NQQSAGQAQ---
A0A3P8QRJ7_BAD-01       --------------------------------------NQQSAGQAQ---
A0A3Q4GGN3_BAD-01       --------------------------------------NQQSARQVQ---
A0A3B4GXJ6_BAD-01       --------------------------------------NQQSAGQAQ---
A0A3Q2D5S0_BAD-01       --------------------------------------NKE---------
A0A3B3BQF7_BAD-01       --------------------------------------LDLAASGGEGGG
A0A3Q1K1C7_BAD-02       --------------------------------------HNQSPPGQE---
A0A3Q1K1C7_BAD-01       --------------------------------------HNQSPPGQE---
A0A3Q1GWH9_BAD-01       --------------------------------------NNHSPATEA---
A0A3Q1CPU7_BAD-01       --------------------------------------NNHSPATQA---
A0A3P8TWH6_BAD-01       --------------------------------------NNHSPATQA---
A0A2U9BAC9_BAD-01       --------------------------------------VSQPWTGPG---
A0A3B4VFC5_BAD-01       --------------------------------------MSQSLTGQE---
A0A3B4W9T1_BAD-01       --------------------------------------MSQSLTGQE---
A0A3Q0QNQ2_BAD-01       --------------------------------------LQLIWGTPR---
A0A3P8WIZ8_BAD-02       --------------------------------------IKHSLNDPE---
A0A3P8WIZ8_BAD-01       --------------------------------------IKHSLNDPE---
A0A3P9A5G8_BAD-02       --------------------------------------DLDHLGTTH---
A0A3P9A5G8_BAD-01       --------------------------------------DLDHLGTTH---
B5X1T1_BAD-01           --------------------------------------ESDHSGTTH---
H3ANP3_BAD-03           --------------------------------------GGRGEGSEP---
H3ANP3_BAD-04           --------------------------------------GGRGEGSEP---
H3ANP3_BAD-02           --------------------------------------GGRGEGSEP---
H3ANP3_BAD-01           --------------------------------------GGRGEGSEP---
A0A3B3QX41_BAD-01       --------------------------------------ANSQLGNNL---
Q4V925_BAD-02           --------------------------------------LDKHKSGSA---
Q4V925_BAD-03           --------------------------------------LDKHKSGSA---
A7MCM4_BAD-01           --------------------------------------LDKHKSGSA---
Q4V925_BAD-04           --------------------------------------LDKHKSGSA---
Q4V925_BAD-01           --------------------------------------LDKHKSGSA---
A0A3P8Y761_BAD-01       --------------------------------------EWIAGQGKT---
A0A3B5K831_BAD-01       --------------------------------------RNSSLSEQE---
A0A3B5Q2N7_BAD-01       --------------------------------------DLQLMQEKE---
A0A087X8P8_BAD-01       --------------------------------------NLQLMQVKE---
A0A3B3UA11_BAD-01       --------------------------------------NLQLMQVKE---
A0A3B3YFR1_BAD-01       --------------------------------------NLQLMQVKE---
A0A3P9Q7C3_BAD-01       --------------------------------------NLQLMQVKE---
A0A3B3HDU2_BAD-01       --------------------------------------LDLGAAAGG---
A0A3B5BAL2_BAD-01       --------------------------------------NNHPPAEQP---
A0A3Q3AEL8_BAD-02       --------------------------------------SKQPAAGPE---
A0A3Q3AEL8_BAD-01       --------------------------------------SKQPAAGPE---
G3Q8B3_BAD-01           --------------------------------------DGQLSSGQE---
A0A3Q2Y0E4_BAD-01       --------------------------------------DGQGAAEKE---
A0A3Q3R5S3_BAD-01       --------------------------------------HSQSSTSQE---
A0A3Q3RXS8_BAD-02       --------------------------------------QKKSSARQE---
A0A3Q3RXS8_BAD-01       --------------------------------------QKKSSARQE---
A0A3Q0QNQ2_BAD-02       --------------------------------------SPFREGSFL---
A0A3Q3WTY4_BAD-01       --------------------------------------NSQLQTEQE---
A0A3B1JXK6_BCL2L11      --------------------------------------PEPGDGDPVRGP
A0A3B4BVX1_BCL2L11      --------------------------------------PEPGEGDPVRGG
A0A3B4BVX1_BCL2L11      --------------------------------------PVRGG-------
A0A3B4BVX1_BCL2L11      --------------------------------------PVRGG-------
A0A3P8XIA2_BCL2L11      --------------------------------------SRGGI-------
A0A3Q1ICY2_BCL2L11      --------------------------------------SSGGG-------
A0A3Q3K6I5_BCL2L11      --------------------------------------SAGGG-------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------STGGG-------
A0A3Q2SZH6_BCL2L11      --------------------------------------AAGGGG------
A0A3B3VNE0_BCL2L11      --------------------------------------AGGGGG------
A0A3B3YII5_BCL2L11      --------------------------------------AGGGGG------
A0A3B3YII5_BCL2L11      --------------------------------------AGGGGG------
A0A3P9N073_BCL2L11      --------------------------------------AGGGGG------
A0A3Q3B113_BCL2L11      --------------------------------------SAAGG-------
A0A3B5M375_BCL2L11      --------------------------------------AGGGGG------
A0A3B5QAM1_BCL2L11      --------------------------------------AGGGGG------
A0A3B5QAM1_BCL2L11      --------------------------------------AGGGGG------
A0A2I3HWI8_BBC3-03      --------------------------------------QVPRAS------
A0A2K6FQZ3_BBC3-04      --------------------------------------QVPGTS------
Q9BXH1_BBC3-05          --------------------------------------QVPRAA------
A0A2R9BZA9_BBC3-01      --------------------------------------QVPRAA------
A0A2I3RGH5_BBC3-03      --------------------------------------QVPRAA------
A0A2K5P2T8_BBC3-03      --------------------------------------QVPRAA------
A0A2K5V8J3_BBC3-03      --------------------------------------QVPRAS------
F7FFP6_BBC3-03          --------------------------------------QVPRAS------
A0A2K6ASP2_BBC3-03      --------------------------------------QVPRAS------
A0A2I3N2Z9_BBC3-03      --------------------------------------QVPRAS------
A0A2K6QZU4_BBC3-04      --------------------------------------QVPRAS------
A0A2R8MW85_BBC3-03      --------------------------------------QVPRAS------
A0A2K6STD6_BBC3-02      --------------------------------------QVPRAS------
G3T2N1_BBC3-01          --------------------------------------LLPGPR------
M3Y0R3_BBC3-01          --------------------------------------LFRAGA------
Q99ML1_BBC3-02          --------------------------------------LLP--A------
Q80ZG6_BBC3-01          --------------------------------------LLP--A------
H0XQ00_BBC3-01          --------------------------------------LLP--A------
A0A3Q2GWE8_BBC3-01      --------------------------------------LLP--A------
A0A3Q1LXZ6_BBC3-01      --------------------------------------LLP--A------
A0A452E3G1_BBC3-01      --------------------------------------LLP--A------
J9NTK9_BBC3-01          --------------------------------------LLP--A------
A0A337SQV0_BBC3-02      --------------------------------------LLP--A------
F1RM01_BBC3-01          --------------------------------------LLP--A------
A0A2K6FQZ3_BBC3-01      --------------------------------------LLP--A------
Q9BXH1_BBC3-06          --------------------------------------LLP--A------
A0A2I3RGH5_BBC3-01      --------------------------------------LLP--A------
H2NZD3_BBC3-01          --------------------------------------LLP--A------
A0A2K6QZU4_BBC3-01      --------------------------------------LLP--A------
A0A0D9S2H2_BBC3-01      --------------------------------------LLP--A------
B4DQK3_BBC3-01          --------------------------------------LLP--A------
A0A3Q3MLA0_BAD-01       --------------------------------------P-HVPQ------
G1SS60_BAD-01           --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------PAPGPALAPSSL
A0A3B4DUY7_BAD-01       --------------------------------------QHSMAS------
A0A337SAW2_BAD-01       --------------------------------------P-RGPG------
A0A2I3TBK7_BAD-01       --------------------------------------P-SGSG------
A0A2R8Z697_BAD-02       --------------------------------------P-SGSS------
A0A2I2Z8C7_BAD-03       --------------------------------------P-SGSG------
Q92934_BAD-03           --------------------------------------P-SGSG------
A0A2K5M0C1_BAD-02       --------------------------------------P-SDCG------
A0A2K5XJR2_BAD-02       --------------------------------------P-SDCG------
A0A2I3MCN5_BAD-03       --------------------------------------P-SDSG------
A0A2K5VCD8_BAD-02       --------------------------------------P-SDSG------
F7GVS7_BAD-02           --------------------------------------P-SDSG------
A0A2K6E7J3_BAD-02       --------------------------------------P-SDSG------
A0A2K5E6K7_BAD-02       --------------------------------------P-PGSG------
A0A2K6TG62_BAD-02       --------------------------------------P-PGSG------
A0A2K5E6K7_BAD-03       --------------------------------------P-PGSG------
A0A2K5HKW9_BAD-02       --------------------------------------P-SDSG------
A0A2K6N1A1_BAD-02       --------------------------------------P-SDSG------
A0A2K6PUM5_BAD-02       --------------------------------------P-SDSG------
A0A2K5M0C1_BAD-03       --------------------------------------P-SDCG------
A0A2K5VCD8_BAD-03       --------------------------------------P-SDSG------
F7GVS7_BAD-03           --------------------------------------P-SDSG------
A0A2K5XJR2_BAD-03       --------------------------------------P-SDCG------
A0A2I3MCN5_BAD-02       --------------------------------------P-SDSG------
A0A2K6E7J3_BAD-03       --------------------------------------P-SDSG------
A0A2I2Z8C7_BAD-04       --------------------------------------P-SGSG------
Q92934_BAD-04           --------------------------------------P-SGSG------
A0A2I3TBK7_BAD-03       --------------------------------------P-SGSG------
A0A2R8Z697_BAD-03       --------------------------------------P-SGSS------
F6SJL0_BAD-02           --------------------------------------P-PGSG------
A0A2K6TG62_BAD-03       --------------------------------------P-PGSG------
G3VRY4_BAD-02           --------------------------------------PRAAPG------
G3VRY4_BAD-01           --------------------------------------PRAAPG------
G1P8C5_BAD-01           --------------------------------------P-PGLN------
A0A452ER54_BAD-02       --------------------------------------P-PGLS------
W5P8G9_BAD-01           --------------------------------------P-PGLS------
G3TP47_BAD-01           --------------------------------------P-SGPS------
G1MI17_BAD-01           --------------------------------------P-PGPG------
A0A287AEF3_BAD-01       --------------------------------------P-----------
M3YNE7_BAD-01           --------------------------------------P-PGLG------
A0A452RJM6_BAD-01       --------------------------------------P-PGPG------
A0A384DJL2_BAD-01       --------------------------------------P-PGPG------
A0A452ER54_BAD-01       --------------------------------------P-PGLT------
F1MUT9_BAD-01           --------------------------------------P-PGLS------
Q3SYZ0_BAD-01           --------------------------------------P-PGLS------
F7DN67_BAD-01           --------------------------------------P-SDPV------
O35147_BAD-01           --------------------------------------P-G---------
H0WVR2_BAD-01           --------------------------------------P-LGPG------
H0V608_BAD-01           --------------------------------------L-GSS-------
A0A2K5E6K7_BAD-01       --------------------------------------P-PGSG------
A0A2K6TG62_BAD-01       --------------------------------------P-PGSG------
A0A0D9R491_BAD-01       --------------------------------------P-SDSG------
A0A2K5M0C1_BAD-01       --------------------------------------P-SDCG------
A0A2K5VCD8_BAD-01       --------------------------------------P-SDSG------
F7GVS7_BAD-01           --------------------------------------P-SDSG------
A0A2K6E7J3_BAD-01       --------------------------------------P-SDSG------
A0A2K5XJR2_BAD-01       --------------------------------------P-SDCG------
A0A2I3MCN5_BAD-04       --------------------------------------P-SDSG------
A0A2K6N1A1_BAD-01       --------------------------------------P-SDSG------
A0A2K6PUM5_BAD-01       --------------------------------------P-SDSG------
A0A2K5HKW9_BAD-01       --------------------------------------P-SDSG------
B4DZQ9_BAD-01           --------------------------------------P-SGSG------
A0A2K6GWV0_BAD-01       --------------------------------------P-SGPG------
F6SJL0_BAD-01           --------------------------------------P-PGSG------
A0A2I3MCN5_BAD-01       --------------------------------------P-SDSG------
A0A2I2Z8C7_BAD-02       --------------------------------------P-SGSG------
A0A2I2Z8C7_BAD-01       --------------------------------------P-SGSG------
Q92934_BAD-01           --------------------------------------P-SGSG------
Q92934_BAD-02           --------------------------------------P-SGSG------
A0A2I3TBK7_BAD-02       --------------------------------------P-SGSG------
A0A2R8Z697_BAD-01       --------------------------------------P-SGSS------
A0A2J8TYJ3_BAD-01       --------------------------------------P-SGSS------
F1PK10_BAD-01           --------------------------------------P-PSPG------
Q45KI9_BAD-01           --------------------------------------P-PSPG------
I3MBM5_BAD-01           --------------------------------------P-G---------
I3MBM5_BAD-02           --------------------------------------P-G---------
Q61337_BAD-05           --------------------------------------P-G---------
Q61337_BAD-04           --------------------------------------P-G---------
Q61337_BAD-03           --------------------------------------P-G---------
Q61337_BAD-06           --------------------------------------P-G---------
Q61337_BAD-02           --------------------------------------P-G---------
Q61337_BAD-01           --------------------------------------P-G---------
I3LVX0_BIK-01           --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
Q9BXH1_BBC3-03          ARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPR-------------
F6TGJ4_BMF-01           TVFNQSQSYTCLLSRFHLFPLSHC-----CGPGCRGA-------------
A0A452H3N6_BMF-01       GIFTQNQSYSCLLGRFQLFPLTHC-----CGPGIRHA-------------
G1PAU1_BMF-01           DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPI-------------
A2AV74_BMF-02           DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPI-------------
A0A286XXB0_BMF-03       DLFAQSQ-LDCPLGRLHLFPLTHC-----CGPGLRPT-------------
I3MDS9_BMF-02           DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A287AIU8_BMF-05       DPFVQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A287AIU8_BMF-04       DPFVQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A287AIU8_BMF-03       DPFVQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A287AIU8_BMF-01       DPFVQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A287AIU8_BMF-02       DPFVQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K5KGR6_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K6FFR1_BMF-02       DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
M3WRS0_BMF-02           NLFAQSQ-LDCPLSHLQLFPLTHC-----CGPGLRPT-------------
A0A2K5E1W9_BMF-02       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
F7HPK0_BMF-02           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K6TW86_BMF-03       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K6RAW8_BMF-02       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
G3QIN5_BMF-02           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
Q96LC9_BMF-07           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
Q96LC9_BMF-05           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2R9BS98_BMF-02       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2J8QDD5_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K5MJY6_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
G7PAW6_BMF-01           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K6B5G4_BMF-03       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K5Z4C3_BMF-02       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A096NTE9_BMF-03       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2I3HD83_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A2AV74_BMF-01           DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPI-------------
Q8K589_BMF-01           DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPV-------------
I3MDS9_BMF-01           DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
G3T7Z4_BMF-01           DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRHT-------------
F6X3N6_BMF-01           ALFAQSQ-PDYMLDGLQLFPLTHC-----CGPGLRSV-------------
G3WDQ2_BMF-01           ALFAQSQ-PDYMLDGLQLFPLTHC-----CGPGLRSV-------------
Q96LC9_BMF-06           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
F6TJI0_BMF-02           DLFAPSQ-LDCPLSHLRLFPLTHC-----CGPGLRPT-------------
F6TJI0_BMF-01           DLFAPSQ-LDCPLSHLRLFPLTHC-----CGPGLRPT-------------
A0A286XXB0_BMF-02       DLFAQSQ-LDCPLGRLHLFPLTHC-----CGPGLRPT-------------
J9PB65_BMF-01           DLFAQSQ-LDCPLSRLHLFPLTHC-----CGPGLRPT-------------
A0A286XXB0_BMF-01       DLFAQSQ-LDCPLGRLHLFPLTHC-----CGPGLRPT-------------
G1SR62_BMF-01           DPFAQSQ-LDCPLGRLHLFPLTHC-----CGPGLRPT-------------
W5QFV1_BMF-01           DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
Q05KI3_BMF-01           DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
Q05KI3_BMF-02           DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A452F2E0_BMF-02       DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A452F2E0_BMF-01       DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
M3WRS0_BMF-01           NLFAQSQ-LDCPLSHLQLFPLTHC-----CGPGLRPT-------------
A0A2U4BC98_BMF-01       DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
M3YAD5_BMF-01           DLFAQSQ-LDCPLSRLHLFPLTHC-----CGPGLRPT-------------
A0A452SED0_BMF-01       DLFAQSQ-LDCPLSRLHLFPLTHC-----CGPGLRPT-------------
A0A384D070_BMF-01       DLFAQSQ-LDCPLSRLHLFPLTHC-----CGPGLRPT-------------
A0A2K6FFR1_BMF-01       DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
H0WYH6_BMF-01           DLFAQSQ-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A096NTE9_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K6L933_BMF-02       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A096NTE9_BMF-02       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K5MJY6_BMF-02       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K5KGR6_BMF-02       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
G7PAW6_BMF-02           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
F7CM09_BMF-02           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K6B5G4_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K6B5G4_BMF-02       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K6B5G4_BMF-04       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K5Z4C3_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K6L933_BMF-03       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K6L933_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K6RAW8_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A0D9R4R5_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
F7HPK0_BMF-01           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K5E1W9_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K6TW86_BMF-02       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2K6TW86_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
G3QIN5_BMF-01           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
Q96LC9_BMF-01           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
Q96LC9_BMF-04           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
Q96LC9_BMF-03           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
Q96LC9_BMF-02           DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2R9BS98_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2J8QDD5_BMF-02       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
A0A2J8T301_BMF-01       DLFAQSL-LDCPLSRLQLFPLTHC-----CGPGLRPT-------------
H9GL49_BMF-01           GIFTQSKSYNCLLGRFQLFPLTHC-----CGPGSRQA-------------
K7FRX2_BMF-01           GIFTQNQSYSCLLGRFQLFPLTHC-----CGPGIRHA-------------
A9XRG9_BMF-01           GIFTQNQSYSCLLGRFQLFPLTHC-----CGPGVRHP-------------
A9XRG9_BMF-02           GIFTQNQSYSCLLGRFQLFPLTHC-----CGPGVRHP-------------
U3JS06_BMF-01           GFFTQNQSYSCLLGRFQLFPLTHC-----CGPGIRHP-------------
H0ZMX5_BMF-01           GFFTQNQSYSCLLGRFQLFPLTHC-----CGPGIRHP-------------
A9XRG9_BMF-03           GIFTQNQSYSCLLGRFQLFPLTHC-----CGPGVRHP-------------
A9XRG9_BMF-04           GIFTQNQSYSCLLGRFQLFPLTHC-----CGPGVRHP-------------
G1NHG8_BMF-01           GIFTQNQSYSCLLGRFQLFPLTHC-----CGPGVRHP-------------
A0A3B4UNJ0_BMF-01       ---------------------SHL-----WGTSFRDV-------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       ---------------------LHC-----WHTTFRQI-------------
Q0GKC7_BMF-01           ---------------------LQH-----WPPPHLQI-------------
A0A3B3RH63_BMF-01       ---------------------PLT-----YQPPFRDI-------------
W5N4P7_BMF-01           --------------------FSHC-----WGTQFREI-------------
A0A3B1K1X5_BMF-01       ---------------------PEP-----WRSPISVI-------------
A0A3B4CNJ8_BMF-01       ---------------------TQY-----WRSSIREI-------------
A0A2U9CJH3_BMF-01       ---------------------PHC-----WRTTFREI-------------
A0A3Q2YCX7_BMF-01       ---------------------PHC-----WRTTFKEI-------------
A0A3Q2YCX7_BMF-02       ---------------------PHC-----WRTTFKEI-------------
A0A3P8ZIE7_BMF-01       ---------------------SYC-----WHTASREI-------------
A0A3Q3QZ16_BMF-01       ---------------------PHC-----WRTAFREI-------------
A0A3Q3QZ16_BMF-02       ---------------------PHC-----WRTAFREI-------------
A0A3Q2PJX9_BMF-02       ---------------------PNC-----WRTPFREI-------------
A0A3Q2PJX9_BMF-03       ---------------------PNC-----WRTPFREI-------------
A0A3Q2PJX9_BMF-01       ---------------------PNC-----WRTPFREI-------------
A0A3B5QK08_BMF-01       ---------------------PNC-----WRTPFREI-------------
A0A3B5QK08_BMF-02       ---------------------PNC-----WRTPFREI-------------
A0A096LRV0_BMF-01       ---------------------PNC-----WRTPFREI-------------
A0A3B3WU80_BMF-01       ---------------------PNC-----WRTPFREI-------------
A0A3P9Q8E2_BMF-01       ---------------------PNC-----WRTPFREI-------------
A0A3Q2E3E8_BMF-02       ---------------------PNS-----WHTPFREI-------------
A0A3Q2E3E8_BMF-01       ---------------------PNS-----WHTPFREI-------------
A0A3Q3GUU5_BMF-01       ---------------------PHS-----WRTYFQEI-------------
A0A3B5B8F6_BMF-01       ---------------------PHC-----WRTTFREI-------------
A0A3P8UA78_BMF-01       ---------------------PHS-----WHTTFREI-------------
A0A3P8UA78_BMF-03       ---------------------PHS-----WHTTFREI-------------
A0A3P8UA78_BMF-02       ---------------------PHS-----WHTTFREI-------------
A0A3B3CGR9_BMF-01       ---------------------PNN-----WRTAVRKI-------------
A0A3B3I0V9_BMF-04       ---------------------PNK-----WRTTARKI-------------
A0A3B3I0V9_BMF-02       ---------------------PNK-----WRTTARKI-------------
A0A3B3I0V9_BMF-01       ---------------------PNK-----WRTTARKI-------------
A0A3B3I0V9_BMF-03       ---------------------PNK-----WRTTARKI-------------
A0A3P9JM16_BMF-03       ---------------------PNK-----WRTTARKI-------------
A0A3P9JM16_BMF-02       ---------------------PNK-----WRTTARKI-------------
A0A3P9JM16_BMF-01       ---------------------PNK-----WRTTARKI-------------
A0A3Q2ZA20_BMF-01       ---------------------PSC-----WRTTFREI-------------
A0A3P8NFE2_BMF-02       ---------------------ANC-----WRTTFREI-------------
I3K2D6_BMF-01           ---------------------ANC-----WRTTFREI-------------
A0A3P8NFE2_BMF-01       ---------------------ANC-----WRTTFREI-------------
A0A3Q3C5V2_BMF-01       ---------------------ANC-----WRTTFREI-------------
A0A3P9DPJ5_BMF-02       ---------------------ANC-----WRTTFREI-------------
A0A3P9DPJ5_BMF-01       ---------------------ANC-----WRTTFREI-------------
A0A3B4ETH0_BMF-01       ---------------------ANC-----WRTTFREI-------------
A0A3Q4G1I4_BMF-01       ---------------------ANC-----WRTTFREI-------------
A0A3Q1FVH7_BMF-01       ---------------------THC-----WRTTFREI-------------
A0A3Q1FVH7_BMF-02       ---------------------THC-----WRTTFREI-------------
A0A3Q1D1K3_BMF-01       ---------------------PHC-----WRTTFREI-------------
A0A3P8RKY9_BMF-01       ---------------------PHC-----WRTTFREI-------------
A0A3Q1IPR4_BMF-01       ---------------------PHC-----WRTTFREI-------------
A0A3B4U5H8_BMF-01       ---------------------PHC-----WRTTFREI-------------
A0A3B4WM88_BMF-01       ---------------------PHC-----WRTTFREI-------------
A0A3Q3LME3_BMF-01       ---------------------PHF-----WRTTFREI-------------
A0A3Q3LME3_BMF-02       ---------------------PHF-----WRTTFREI-------------
A0A3Q3LME3_BMF-03       ---------------------PHF-----WRTTFREI-------------
A0A3Q3VLX6_BMF-01       ---------------------AHC-----WRTTFREI-------------
A0A3B5KWG6_BMF-01       ---------------------PYS-----WRTTFQEI-------------
A0A286XF37_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------RAELP-PEFAAQLRKIGD
Q5U777_PMAIP1-01        --------------------------------RAELP-PEFAAQLRKIGD
F1SMU1_PMAIP1-01        -----------------------------AACYLQSQ-------------
A0A3B3QC78_BCL2L11      VPG-----------------------------QLQAT-------------
A0A3Q2U844_BCL2L11      --------------------------------ALPGA-----ARPA----
G3SU55_BCL2L11-01       --------------------------------SLLTE-----PQGNPDGE
G3W979_BCL2L11-01       --------------------------------SIQTQ-----YQGN-SGE
A0A2K6KS56_BBC3-02      --------------------------------RLNAQ-------------
A0A3Q3SYA1_BCL2L11      --------------------------------HLDSL-------------
A0A2K5JY52_PMAIP1-      LGPAKTQ----------------------AGRGRG------RGKKLL---
A0A096MPU8_PMAIP1-      AGTARDQ----------------------AGFGIGMQLHFTRSKKLV---
A0A2K5ZWH1_PMAIP1-      AGTARDQ----------------------AGFGIGMQLHFTRGKKLV---
A0A2K5VPX2_PMAIP1-      AGTARDQ----------------------AGFGIGMQLHYTRGKKLV---
A0A2K6BV75_PMAIP1-      AGTARDQ----------------------AGFGIGMQLHYTRGKKLV---
A0A2K6KJF2_PMAIP1-      AGTARDQ----------------------AGLGIGMQLHFTRGKKLL---
A0A2K6NC45_PMAIP1-      AGTARDQ----------------------AGLGIGMQLHFTRGKKLL---
Q13794_PMAIP1-02        AGTARDQ----------------------AGFAIGMQLRFTRGKKLLSSS
A0A2R9AKC9_PMAIP1-      AGTARDQ----------------------AGFGIGMQLRFTRGKKLLSSS
A0A1D5QGJ8_PMAIP1-      AGTARDQ----------------------AGFGIGMQLHYTRGKKLVSSS
A0A2I2YVQ5_PMAIP1-      AGTARDQ----------------------AGFGIEMQLRFTRGKKLLSSS
A0A2I3SX38_PMAIP1-      AGTARDQ----------------------AGFGIGMQLRFTRGKKLLSSS
C1C3S9_BAD-01           --------------------------------GDPGH-KSSPNLRRIKGK
A0A3B4CPH6_BAD-01       --------------------------------DSFRR-RCRSAPPALWAA
F6Z067_BAD-01           ---------------------------------------VAKSSPSLRRY
A0A3Q2LHE3_BIK-01       ----------------------------------T------ESSPDSDNR
A0A452QUG1_BIK-01       -----------------------------------------ATGPLCNNP
A0A452V3L2_BIK-01       ----------------------------------VEY-YDPGPSPNSNNP
M3XHJ5_BCL2L11-01       --------------------------------DQPPF-VKQEGCYCIISP
W5QCU2_BIK-01           --------------------------------EFHPI-SPYS-----DSP
O70337_BIK-04           ----------------------------------------------MFTR
O70337_BIK-01           -----------------------------------PV-RDVDLMECVEGR
O70337_BIK-02           -----------------------------------PV-RDVDLMECVEGR
Q925D2_BIK-01           --------------------------------DVSPV-RDLDFMRCLESR
G1TZR9_BIK-01           --------------------------------DLD-------LMECLEGS
H0W025_BIK-01           --------------------------------DLSPP-GDTNLMECVEGS
A0A2K5CLG5_BIK-01       --------------------------------DLDPV-ED--PLECMENS
F7FUT7_BIK-01           --------------------------------DLDPV-ED--PLECMENS
A0A2K6TBD7_BIK-01       --------------------------------DPDSV-ED--PLECMENS
H2P4N6_BIK-01           --------------------------------DLDPM-EDFSPLECMEGS
G1S1X2_BIK-01           --------------------------------DLDPM-EDFDPLQCMEGS
G3QCT2_BIK-01           --------------------------------DLDPM-EDFDSLECMEGS
A0A2R8ZXD2_BIK-01       --------------------------------DLDPM-EDFDSLECMEGS
H2QLU7_BIK-01           --------------------------------DLDPM-EDFDSLECMEGS
Q13323_BIK-01           --------------------------------DLDPM-EDFDSLECMEGS
A0A2K6MCW0_BIK-01       --------------------------------DLDPM-EDFDPLECMEDS
A0A2K6QK74_BIK-01       --------------------------------DLDPM-EDFDPLECMEDS
A0A0D9QZY8_BIK-01       --------------------------------DLDPM-EDFDPLECMEDS
A0A2K5VW94_BIK-01       --------------------------------DLDPM-EDFNPLECMEDS
A0A2K6DBJ4_BIK-01       --------------------------------DLDPM-EDFDPLECIEDS
A0A2K5J4Q7_BIK-01       --------------------------------DLDPM-EDFDPLECMEDS
A0A096NKG5_BIK-01       --------------------------------DLDPM-EDFDPLECMEDS
A0A2K5LDM6_BIK-01       --------------------------------DLDPM-EDFDPLECMEDS
A0A2K5XSA1_BIK-01       --------------------------------DLDPM-EDFDPLECMEDS
F1PUF4_BIK-01           --------------------------------YYDP-----GPSPNSNNP
H0XAE7_BIK-01           -----------------------------------P-----NPMECLEDS
A0A2K6FM79_BIK-01       ----------------------------------NP-----DPSGCLEDS
A0A3P8XIA2_BCL2L11      ---------------------------------FRTT-------------
F7G1G0_HRK-01           --------------------------------RLEQRAAA----------
P62816_HRK-03           --------------------------------RPGLR-WA----------
P62817_HRK-01           --------------------------------RPGLR-WA----------
A0A287A5N9_HRK-01       --------------------------------RLGLR-SS----------
H2NIS8_HRK-01           --------------------------------RLGLR-SS----------
A0A2K5KZ69_HRK-01       --------------------------------RLGLR-SS----------
H2Q6Y8_HRK-01           --------------------------------RLGLR-SS----------
G3UH24_HRK-01           --------------------------------RLGLR-SS----------
A0A2K5BYA0_HRK-01       --------------------------------RLGLR-SS----------
U3E722_HRK-01           --------------------------------RLGLR-SS----------
A0A452DXE5_HRK-01       --------------------------------RLGLR-SS----------
A0A0D9SC73_HRK-01       --------------------------------RLGLR-SS----------
A0A3Q2IBL3_HRK-01       --------------------------------RLGLR-SS----------
A0A337SQ56_HRK-01       --------------------------------RLGLR-SS----------
G3QTJ6_HRK-01           --------------------------------RLGLR-SS----------
O00198_HRK-01           --------------------------------RLGLR-SS----------
A0A1D5R1E4_HRK-01       --------------------------------RLGLR-SS----------
A0A2K6AYL7_HRK-01       --------------------------------RLGLR-SS----------
G1QHD8_HRK-01           --------------------------------RLGLR-SS----------
G1T7W1_HRK-01           --------------------------------RLGLR-SA----------
H0Y001_HRK-01           --------------------------------RLGLR-SS----------
A0A096N944_HRK-01       --------------------------------RLGLR-SS----------
A0A2K6GL98_HRK-01       --------------------------------RLGLR-SS----------
E2RLD4_HRK-01           --------------------------------RLALR-SS----------
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
A0A452IFQ4_BAD-01       VRSRIGS----------------------DTPSLEPE-VQDEPGGAFRAR
K7GA86_BCL2L11-01       --------------------------------SIQTQ-YQ----------
A0A3Q2GRS5_BCL2L11      --------------------------------SLQIE-QQ----------
Q4KMV9_BCL2L11-01       --------------------------------SLSSP-FQ----GNQSDE
F7FTC8_BCL2L11-01       --------------------------------SIRTQ-YQ----------
A0A2K6E226_BCL2L11      --------------------------------SLQTD-P-----------
O43521_BCL2L11-11       --------------------------------SLQTE-PQ----------
F7HHA9_BCL2L11-08       --------------------------------SLQTE-PQ----------
O54918_BCL2L11-06       --------------------------------SLQTE-PQ----------
O54918_BCL2L11-08       --------------------------------SLQTE-PQ----------
O54918_BCL2L11-03       --------------------------------SLQTE-PQ----------
A0A2I3HW02_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K6TRZ5_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5HZI7_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5NU92_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5Z8B6_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2I2YQ13_BCL2L11      --------------------------------SLQTE-PQ----------
O43521_BCL2L11-15       --------------------------------SLQTE-PQ----------
A0A2R9CA99_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2J8JCT2_BCL2L11      --------------------------------SLQTE-PQ----------
F7HHA9_BCL2L11-07       --------------------------------SLQTE-PQ----------
A0A2K5CAB2_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5X2I7_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2I3M6I1_BCL2L11      --------------------------------SLQTE-PQ----------
O43521_BCL2L11-07       --------------------------------SLQTE-PQ----------
O43521_BCL2L11-22       --------------------------------SLQTE-PQ----------
A0A452U4S4_BCL2L11      --------------------------------SLQTE-QQ----------
C1KGB8_BCL2L11-01       --------------------------------SLQTE-RQ----------
A0A2K6GE31_BCL2L11      --------------------------------SLQTE-PQ----------
A0A337SW42_BCL2L11      --------------------------------SLQTE-QQ----------
O43521_BCL2L11-17       --------------------------------SLQTE-PQ----------
O43521_BCL2L11-10       --------------------------------SLQTE-PQ----------
A0A2I2YQ13_BCL2L11      --------------------------------SLQTE-PQ----------
O43521_BCL2L11-19       --------------------------------SLQTE-PQ----------
O43521_BCL2L11-13       --------------------------------SLQTE-PQ----------
A0A2I3HW02_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2R9CA99_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2J8JCT2_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5NU92_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5X2I7_BCL2L11      --------------------------------SLQTE-PQ----------
F7HHA9_BCL2L11-05       --------------------------------SLQTE-PQ----------
A0A2K5Z8B6_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5HZI7_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K6KJP8_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K6QIL2_BCL2L11      --------------------------------SLQTE-PQ----------
O54918_BCL2L11-05       --------------------------------SLQTE-PQ----------
O88498_BCL2L11-02       --------------------------------SLQTE-SQ----------
A0A0D9RWE0_BCL2L11      --------------------------------SLQTE-PQ----------
O43521_BCL2L11-05       --------------------------------SLQTE-PQ----------
O43521_BCL2L11-25       --------------------------------SLQTE-PQ----------
F1SU81_BCL2L11-03       --------------------------------SLQTE-RQ----------
A0A2K6GE31_BCL2L11      --------------------------------SLQTE-PQ----------
A0A286XJN2_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5CAB2_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K6TRZ5_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K6QIL2_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5NU92_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5HZI7_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5X2I7_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K6E226_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5Z8B6_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2I3M6I1_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2I3M6I1_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K6KJP8_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2I2YQ13_BCL2L11      --------------------------------SLQTE-PQ----------
O43521_BCL2L11-02       --------------------------------SLQTE-PQ----------
A0A2R9CA99_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2J8JCT2_BCL2L11      --------------------------------SLQTE-PQ----------
H2P5E2_BCL2L11-01       --------------------------------SLQTE-PQ----------
A0A337SW42_BCL2L11      --------------------------------SLQTE-QQ----------
A0A452SBG5_BCL2L11      --------------------------------SLQTE-QQ----------
Q2YDF0_BCL2L11-01       --------------------------------SLQTE-RQ----------
A0A287DFJ0_BCL2L11      --------------------------------SLQTE-PQ----------
Q2YDF0_BCL2L11-03       --------------------------------SLQTE-RQ----------
A0A452FCS1_BCL2L11      --------------------------------SLQTE-RQ----------
A0A2K5CAB2_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5Z8B6_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K6KJP8_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K6QIL2_BCL2L11      --------------------------------SLQTE-PQ----------
F6XMC1_BCL2L11-09       --------------------------------SLQTE-PQ----------
A0A2K6TRZ5_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5HZI7_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2R9CA99_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2J8JCT2_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5NU92_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2K5X2I7_BCL2L11      --------------------------------SLQTE-PQ----------
F7HHA9_BCL2L11-09       --------------------------------SLQTE-PQ----------
A0A2K6E226_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2I3M6I1_BCL2L11      --------------------------------SLQTE-PQ----------
A0A2I2YQ13_BCL2L11      --------------------------------SLQTE-PQ----------
O43521_BCL2L11-06       --------------------------------SLQTE-PQ----------
O43521_BCL2L11-23       --------------------------------SLQTE-PQ----------
A0A2I3HW02_BCL2L11      --------------------------------SLQTE-PQ----------
M3YDI3_BCL2L11-01       --------------------------------SLQTE-QQ----------
F6XMC1_BCL2L11-02       --------------------------------SLQTE-PQ----------
F6XMC1_BCL2L11-01       --------------------------------SLQTE-PQGNPEGNHGGE
F7CXT2_BCL2L11-01       --------------------------------SIQTQ-YQGNS-----GE
O54918_BCL2L11-01       --------------------------------SLQTE-PQGNPDG----E
O88498_BCL2L11-01       --------------------------------SLQTE-SQGNPDG----E
A0A337SW42_BCL2L11      --------------------------------SLQTE-QQGNPE----GE
A0A337SW42_BCL2L11      --------------------------------SLQTE-QQGNPE----GE
A0A2K5NU92_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5HZI7_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I2YQ13_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
O43521_BCL2L11-24       --------------------------------SLQTE-PQGNPEGNHGGE
O43521_BCL2L11-08       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5X2I7_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
F7HHA9_BCL2L11-03       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6E226_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5Z8B6_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I3HW02_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2R9CA99_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2J8JCT2_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I3M6I1_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6KJP8_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2K6QIL2_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2K5CAB2_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
F6XMC1_BCL2L11-06       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6TRZ5_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5CAB2_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6TRZ5_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5CAB2_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
F6XMC1_BCL2L11-04       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6TRZ5_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5NU92_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I2YQ13_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
O43521_BCL2L11-18       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5X2I7_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
F7HHA9_BCL2L11-01       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6E226_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5Z8B6_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I3HW02_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2R9CA99_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2J8JCT2_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I3M6I1_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6KJP8_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2K6QIL2_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2K5NU92_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5HZI7_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I2YQ13_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
O43521_BCL2L11-16       --------------------------------SLQTE-PQGNPEGNHGGE
O43521_BCL2L11-12       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5X2I7_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
F7HHA9_BCL2L11-06       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6E226_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5Z8B6_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I3HW02_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2R9CA99_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2J8JCT2_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I3M6I1_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6KJP8_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2K6QIL2_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2K5HZI7_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6GE31_BCL2L11      --------------------------------SLQTE-PQGNPEGSREGE
A0A2K6GE31_BCL2L11      --------------------------------SLQTE-PQGNPEGSREGE
F6XMC1_BCL2L11-08       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6GE31_BCL2L11      --------------------------------SLQTE-PQGNPEGSREGE
A0A2K6GE31_BCL2L11      --------------------------------SLQTE-PQGNPEGSREGE
A0A287DFJ0_BCL2L11      --------------------------------SLQTE-PQGNPEG----E
A0A286XJN2_BCL2L11      --------------------------------SLQTE-PQGNPEG----A
A0A286XJN2_BCL2L11      --------------------------------SLQTE-PQGNPEG----A
A0A2K5CAB2_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
F6XMC1_BCL2L11-07       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6TRZ5_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
F6XMC1_BCL2L11-05       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6TRZ5_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5CAB2_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5NU92_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5HZI7_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5X2I7_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
F7HHA9_BCL2L11-02       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6E226_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5Z8B6_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I3M6I1_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6KJP8_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2K6QIL2_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2I2YQ13_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
O43521_BCL2L11-09       --------------------------------SLQTE-PQGNPEGNHGGE
O43521_BCL2L11-21       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2R9CA99_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2J8JCT2_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5NU92_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5HZI7_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5X2I7_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
F7HHA9_BCL2L11-04       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6E226_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5Z8B6_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I3M6I1_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6KJP8_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2K6QIL2_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2I2YQ13_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
O43521_BCL2L11-20       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I3HW02_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2R9CA99_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2J8JCT2_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5CAB2_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5CAB2_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
F6XMC1_BCL2L11-03       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6TRZ5_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6TRZ5_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6QIL2_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2K6QIL2_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2K5NU92_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5HZI7_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5X2I7_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6E226_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6E226_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K5Z8B6_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I3M6I1_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2K6KJP8_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2K6KJP8_BCL2L11      --------------------------------SLQTE-PQGNPEDNHGGE
A0A2I2YQ13_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
O43521_BCL2L11-03       --------------------------------SLQTE-PQGNPEGNHGGE
A0A2I3HW02_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2R9CA99_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A2J8JCT2_BCL2L11      --------------------------------SLQTE-PQGNPEGNHGGE
A0A337SW42_BCL2L11      --------------------------------SLQTE-QQGNPEG----E
A0A452FCS1_BCL2L11      --------------------------------SLQTE-RQGNPEG----E
W5PY58_BCL2L11-01       --------------------------------SLQTE-RQGNPEG----E
Q2YDF0_BCL2L11-02       --------------------------------SLQTE-RQGNPEG----E
F1SU81_BCL2L11-02       --------------------------------SLQTE-RQGNPEG----E
G1SSY0_BCL2L11-01       --------------------------------SLQSE-PQGNP------E
H0XW23_BCL2L11-01       --------------------------------SLHTE-PQGNPEGNPEVE
A0A337SW42_BCL2L11      --------------------------------SLQTE-QQGNPEG----E
G1LDR8_BCL2L11-01       --------------------------------SLQTE-QQGNPEG----E
J9NWV6_BCL2L11-01       --------------------------------SLQTE-QQGNPEG----E
F1SU81_BCL2L11-01       --------------------------------SLQTE-RQGNPEG----E
                                                                          

A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
K7E5Y2_BBC3-01          EPVEGLPRESPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAP
A9XRH0_BMF-01           GNAGY---RLHVPPVGFALDPNLQEEPQEG--QREARTEVQIARKLQC--
R4G9R5_BCL2L11-01       GRRWC-----EAETSRWQSRPIPEDMQPEIWIAQELR---RIGDEFNA--
A3KND0_BMF-01           QSYTCLLGRFHLFPFSHCCGPGCRGTDNEDKATQ------TLGSPSQD--
Q6P7C5_BAD-01           EQEDA-------STTDRGLGPSLTEDQPGPYLAPG-----LLGSIVQQ--
A0A287AEF3_BAD-02       EQEDS-------SPADRGLGPSPTGTDPQAPASPGARPQATWGKLVTSRG
Q9BXH1_BBC3-04          --------------STTWVPCQICETRGAAAAPPLTLEGPVQSHHGTPAL
A0A2K5F6X4_BBC3-02      -----------KCGVGSAWACPCQVPRASSSTWVPCQMC-----------
A0A337SQV0_BBC3-03      ----------YLGGGGLGESCVCARARCVGVTPWVCVAC-----------
A0A3P8RLE2_BCL2L11      --------AGVSAKTSRLNSTGGEPDSPSWSRAQASLGVFQTRSIFHLPR
A0A3B1JLM2_BAD-01       PIDDHDESRWSEAVKSVDSPQTDSGPSMYRDTSSDELLEVGGRVRLYSES
A0A3Q2LHE3_BIK-02       --------SSSYSVPKAVWSSVGEEMS------QVGPVSRDLFLDAFLHE
E7FBJ6_BAD-01           LKGTIKNHGQHQDRTSAN-ISPQGRVRLYSESQVYT-VSRW---------
B5XEF1_BAD-01           VSTTMSNRPR-----------PGERVRLYSESQVRSQVGKR---------
H3D8J8_BAD-01           ---------------ERGSFSTSGRIRVNSESQASAVSRDE---------
A0A3B5L9R9_BAD-01       ----------------------RGDLQLMQEKEKPLSQRHTLTLPELRS-
Q9GL49_PMAIP1-01        LLESAGWEELVRSQPRAHQGLTSGRCGQTRREELRGSFGPP---------
A0A3B1IH05_BAD-01       ----PSRSGQHITVPE--------KLRVEPRQRNFSMNEEA---------
A0A3Q2QC80_BAD-01       ---EPLRQRHALTLPELR--SGHGRIRLNSESHASTISREE---------
A0A3Q3MLA0_BAD-02       ---PHVPQRHSLTLPELR-LAGTGRIRLNSESHAYTVSRDE---------
A0A3Q3MLA0_BAD-03       ---PHVPQRHSLTLPELR-LAGTGRIRLNSESHAYTVSRDE---------
I3K7B6_BAD-01           -----ESKPQTLALPVIK-TT------VQPNQWNALGMRDE---------
A0A3P9B2E4_BAD-01       -----ESKPQTLSLPVTK-TTAAGRLRVNSESHTSSIARDE---------
A0A3Q3C680_BAD-01       -----ESKPQTLSLPVIK-TTAAGRLRVNSESHTSSIARDE---------
A0A3P8QRJ7_BAD-01       -----ESKPQTLSLPVTK-TTAAGRLRVNSESHTSSIARDE---------
A0A3Q4GGN3_BAD-01       -----ESKPQTLSLPVIK-TTAAGRLRVNSESHTSSIARDE---------
A0A3B4GXJ6_BAD-01       -----ESKPQTLSLPVIK-TTAAGRLRVNSESHTSSIARDE---------
A0A3Q2D5S0_BAD-01       --------------PRIR-NSGKTHRRIRLSSESHAFTREE---------
A0A3B3BQF7_BAD-01       GGGGHLHDRHALTLPELR-LTSNGRTRLNSESTVSTYSRDE---------
A0A3Q1K1C7_BAD-02       ---QQVFPRHTLTLPELR---ASGRIRLNSESHASTVYRDE---------
A0A3Q1K1C7_BAD-01       ---QQVFPRHTLTLPELR---ASGRIRLNSESHASTVYRDE---------
A0A3Q1GWH9_BAD-01       ---MPVFARRNMALPELR-TPASGRIRLNSESHASTLSRDE---------
A0A3Q1CPU7_BAD-01       ---MPVFARRNMALPELR-TPASGRLRLNSESHASTLSRDE---------
A0A3P8TWH6_BAD-01       ---MPVFARRNMALPELR-TPASGRLRLNSESHASTLSRDE---------
A0A2U9BAC9_BAD-01       ---EQVPPRHTLALPELR-MAATGRIRLNSESNASTLSRDE---------
A0A3B4VFC5_BAD-01       ---QELSQRHTLTLPELR-GAATGRTRLNSESHTSTVSRDE---------
A0A3B4W9T1_BAD-01       ---QELSQRHTLTLPELR-GAATGRTRLNSESHTSTVSRDE---------
A0A3Q0QNQ2_BAD-01       ---HSQAIGHDQNTSPMR-HPTARRIRMNSESHTSSVSRDE---------
A0A3P8WIZ8_BAD-02       ---QVVPHRHNLTLPELR-VAGSRRIRLNSESHASTISREE---------
A0A3P8WIZ8_BAD-01       ---QVVPHRHNLTLPELR-VAGSRRIRLNSESHASTISREE---------
A0A3P9A5G8_BAD-02       YP---EFQFCNTSTNTSNRTLPGVRVRLYSESQVCSQVGRQ---------
A0A3P9A5G8_BAD-01       YP---EFQFCNTSTNTSNRTLPGVRVRLYSESQVCSQVGRQ---------
B5X1T1_BAD-01           YP---EFQRHYVSTRTGIRPRPGGRVRLYSESQVCSQVGRR---------
H3ANP3_BAD-03           SEKTAGLKKHSRTAPNLQ-NPGPHQSHPPSHTGVYGWVKLR---------
H3ANP3_BAD-04           SEKTAGLKKHSRTAPNLQ-NPGPHQSHPPSHTVFWGFT------------
H3ANP3_BAD-02           SEKTAGLKKHSRTAPNLQ-NPGPHQSHPPSH------T------------
H3ANP3_BAD-01           SEKTAGLKKHSRTAPNLQ-NPGPHQSHPPSH------T------------
A0A3B3QX41_BAD-01       KN-------------TKNPGEAGGRVRMRSESQVSSIRSED---------
Q4V925_BAD-02           QK------KQHLTVPDRLKGEQLGRQR-----------------------
Q4V925_BAD-03           QK------KQHLTVPDRLKGEQLGRQR-----------------------
A7MCM4_BAD-01           QK------KQHLTVPDRLKGEQLGRQR-----------------------
Q4V925_BAD-04           QK------KQHLTVPDRLKGEQLGRQR-----------------------
Q4V925_BAD-01           QK------KQHLTVPDRLKGEQLGRQR-----------------------
A0A3P8Y761_BAD-01       GS----RLGLSLNLP------GEGRIRLNSESQVFATSGGE---------
A0A3B5K831_BAD-01       RQ--V-LQRHTLTLPELR-LTGTSRTRVSSESQASTFSR-E---------
A0A3B5Q2N7_BAD-01       KP--L-SQRHTLTLPELR--STTGRVRLNSESIASTISR-E---------
A0A087X8P8_BAD-01       RP--L-SQRHTLTLPELR--STTGRVRLNSESIASTISR-E---------
A0A3B3UA11_BAD-01       RP--L-SQRHTLTLPELR--STTGRVRLNSESIASTISR-E---------
A0A3B3YFR1_BAD-01       RP--L-SQRHTLTLPELR--STTGRVRLNSESIASTISR-E---------
A0A3P9Q7C3_BAD-01       RP--L-SQRHTLTLPELR--STTGRVRLNSESIASTISR-E---------
A0A3B3HDU2_BAD-01       EGEHL-HDRHSLTLPELR-LTSNGRTRLNSESTASTYSRDE---------
A0A3B5BAL2_BAD-01       MH--V-FERRNLALPELR-TPAAGRIRLNSESHATTVSR-D---------
A0A3Q3AEL8_BAD-02       DG-----VRQRLTLPELR-HSKNGRLRVNSESLSSTSSRGE---------
A0A3Q3AEL8_BAD-01       DG-----VRQRLTLPELR-HSKNGRLRVNSESLSSTSSRGE---------
G3Q8B3_BAD-01           QQ--R-LQRHTLTLPELRLSGRKSQRIVEKE-------------------
A0A3Q2Y0E4_BAD-01       QEQCL-RQGLRLTLPELPMEAMSGRIRLNSESHALAVSR-E---------
A0A3Q3R5S3_BAD-01       QQ--V-PPCHSLTLPELRMAATS-RNRVSSESNASTVQ------------
A0A3Q3RXS8_BAD-02       QQ--V-SQRHALALPELR-------------TTASNRIRLS---------
A0A3Q3RXS8_BAD-01       QQ--V-SQRHALALPELR-------------TTASNRIRLS---------
A0A3Q0QNQ2_BAD-02       LL--VSVISFFWSLPKAF-------------SR-------D---------
A0A3Q3WTY4_BAD-01       QQ--V-FQRHTLTLPELR-------------MA-------G---------
A0A3B1JXK6_BCL2L11      PALHNSLLGYQTRSPLFRTLSRSSSGYFSFDSEPSS-PLLMHSASTQTPS
A0A3B4BVX1_BCL2L11      ITMPNSLLGYQSRSPLFRTLSRSSSGYFSFESEPSS-PLVTHSASTQTPS
A0A3B4BVX1_BCL2L11      ------------------------------ITMPNSLLGYQSRSPLFRTL
A0A3B4BVX1_BCL2L11      ------------------------------ITMPNSLLGYQSRSPLFRTL
A0A3P8XIA2_BCL2L11      ------------------------------MMPTNSLLGFQSRSPLFRTT
A0A3Q1ICY2_BCL2L11      ------------------EPESQSRCRTKSSSSSDGLGVF--RS-VFRLP
A0A3Q3K6I5_BCL2L11      ------------------EPVSPSRCRTKAIAPLDSLSVFHTRS-IFHLP
A0A3B4V919_BCL2L11      --------------QRRAEPWPPRLHRRRRARLAAPVQNHSHLS-CQHFS
A0A3B4XZH1_BCL2L11      --------------QRRAETIA--------TSPGNSLGVFQKRS-IFSYP
A0A3Q3ESW6_BCL2L11      ------------------EPDSPSRCRFKPVSPVDSLGVFQKRS-IFHLP
A0A3Q2SZH6_BCL2L11      ---------------GEPDSDSPPRS----IS-PNSLDVFQRRS-IF---
A0A3B3VNE0_BCL2L11      --------GGGGG-GGEPDADSPPCS----VS-PASLDVFRSRS-IFRPP
A0A3B3YII5_BCL2L11      --------GGGGG-RGEPDSDSPPCS----VS-PASLDVFRSRS-IFRPP
A0A3B3YII5_BCL2L11      --------GGGGG-RGEPDSDSPPCS----VS-PASLDVFRSRS-IFRPP
A0A3P9N073_BCL2L11      --------GG----RGEPDSDSPPCT----VS-PASLDVFRSRS-IFRPP
A0A3Q3B113_BCL2L11      ------------------EPESPACS----SNPPAGLDVFRSRS-IFRFP
A0A3B5M375_BCL2L11      --------GEGEGRRGEPDSDSPPCS----VS-PASLDVFRSRS-IFRPT
A0A3B5QAM1_BCL2L11      --------GEGGGRRGEPDSDSPPCS----VS-PASLDVFRSRS-IFRPP
A0A3B5QAM1_BCL2L11      --------GEGGGRRGEPDSDSPPCS----VS-PASLDVFRSRS-IFRPP
A0A2I3HWI8_BBC3-03      ---------------SVTWVPCQI--------------------------
A0A2K6FQZ3_BBC3-04      ---------------FSWWVLGHI--------------------------
Q9BXH1_BBC3-05          ---------------STTWVPCQI--------------------------
A0A2R9BZA9_BBC3-01      ---------------SVTWVPCQI--------------------------
A0A2I3RGH5_BBC3-03      ---------------SATWVPCQI--------------------------
A0A2K5P2T8_BBC3-03      ---------------SATWVLCQI--------------------------
A0A2K5V8J3_BBC3-03      ---------------SATWVPCQI--------------------------
F7FFP6_BBC3-03          ---------------SATWVPCQI--------------------------
A0A2K6ASP2_BBC3-03      ---------------SATWVPCQI--------------------------
A0A2I3N2Z9_BBC3-03      ---------------SATWVPCQI--------------------------
A0A2K6QZU4_BBC3-04      ---------------SATWVPCQI--------------------------
A0A2R8MW85_BBC3-03      ---------------SSVWVPCQM--------------------------
A0A2K6STD6_BBC3-02      ---------------SLTWVPCQM--------------------------
G3T2N1_BBC3-01          ---------------TQLFPSPSPVWVSDLSGLQLERGGAEWEDRAPRPL
M3Y0R3_BBC3-01          ---------------AAVSQPPPPPVWVSLTSQRTIVGGSVGRARGLLF-
Q99ML1_BBC3-02          ---------------AYLCAPTAPPAVTAALGGPRWPGGHRSRPRGPRP-
Q80ZG6_BBC3-01          ---------------AYLCAPTAPPAVTAALGGPRWPGGHRSRPRGPRP-
H0XQ00_BBC3-01          ---------------AYLCAPTAPPAVTATLGGPRWPGGPRSRPRGPRL-
A0A3Q2GWE8_BBC3-01      ---------------AYLCAPAAPPAVTAALGGPRWPGGPRSRPRAPRP-
A0A3Q1LXZ6_BBC3-01      ---------------AYLCAPTAPPAVTAALGAPRWPGGPRSRPRGPRP-
A0A452E3G1_BBC3-01      ---------------AYLCAPTAPPAVTAALGAPRWPGGPRSRPRGPRP-
J9NTK9_BBC3-01          ---------------AYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-
A0A337SQV0_BBC3-02      ---------------AYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-
F1RM01_BBC3-01          ---------------AYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-
A0A2K6FQZ3_BBC3-01      ---------------AYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-
Q9BXH1_BBC3-06          ---------------AYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRP-
A0A2I3RGH5_BBC3-01      ---------------AYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-
H2NZD3_BBC3-01          ---------------AYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-
A0A2K6QZU4_BBC3-01      ---------------AYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-
A0A0D9S2H2_BBC3-01      ---------------AYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-
B4DQK3_BBC3-01          ---------------AYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRP-
A0A3Q3MLA0_BAD-01       --------RHSLTLPELRLAGTGRIRLNSESHAYTV--------------
G1SS60_BAD-01           ----------------------------PRPKPLSA-GA----GAMETR-
K7E5Y2_BBC3-02          LPLAYFCTRQPRAYGGPRWARAARS---PAAGNQGQSGSLPSLGPRSAQE
A0A3B4DUY7_BAD-01       --------NISPASPDELSEVGCRVRLYSESQVYTV--------------
A0A337SAW2_BAD-01       --------KHQRTTPGLLGEAGHQQGQ-PASSNHHG-GA----GAVETR-
A0A2I3TBK7_BAD-01       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-EG----T--SSPE
A0A2R8Z697_BAD-02       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-EG----T--SSPE
A0A2I2Z8C7_BAD-03       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-EG----T--SSPE
Q92934_BAD-03           --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-EG----T--SSPE
A0A2K5M0C1_BAD-02       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GT-------SSPE
A0A2K5XJR2_BAD-02       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GT-------SSPE
A0A2I3MCN5_BAD-03       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GT-------SSPE
A0A2K5VCD8_BAD-02       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GT-------SSPE
F7GVS7_BAD-02           --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GT-------SSPE
A0A2K6E7J3_BAD-02       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GT-------SSPE
A0A2K5E6K7_BAD-02       --------KHPRQAPGLPGDASHQQGQ-PTSSSHHG-GT-------SSPE
A0A2K6TG62_BAD-02       --------KHRRQAPGLPGDASHQQGQ-PTSSSHHG-GT-------SSPE
A0A2K5E6K7_BAD-03       --------KHPRQAPGLPGDASHQQGQ-PTSSSHHG-GE------YSTCA
A0A2K5HKW9_BAD-02       --------KHHRQAPGLLWDASHQQEQ-ATSSSHHG-GR----AWYSPS-
A0A2K6N1A1_BAD-02       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GR----AWYYPA-
A0A2K6PUM5_BAD-02       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GR----AWYYPA-
A0A2K5M0C1_BAD-03       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GG----AWYSPSW
A0A2K5VCD8_BAD-03       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GR----AWYSPSW
F7GVS7_BAD-03           --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GR----AWYSPSW
A0A2K5XJR2_BAD-03       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GG----AWYSPSW
A0A2I3MCN5_BAD-02       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GR----AWYSPSW
A0A2K6E7J3_BAD-03       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GR----AWYSPSW
A0A2I2Z8C7_BAD-04       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GR----TSYSPSW
Q92934_BAD-04           --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GR----TSYSPSW
A0A2I3TBK7_BAD-03       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GR----TSYSPSW
A0A2R8Z697_BAD-03       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GR----TSYSPSW
F6SJL0_BAD-02           --------KHRRQAPGLPGDASHQQGQ-STSSSHHG--------------
A0A2K6TG62_BAD-03       --------KHRRQAPGLPGDASHQQGQ-PTSSSHHG--------------
G3VRY4_BAD-02           --------AHHHEKGGAQKSQTHVSKELKASASQGRLGK----GSFEGRE
G3VRY4_BAD-01           --------AHHHEGAGAGRPRLISYPPL--------------------RE
G1P8C5_BAD-01           --------KHWSTVPGLLGEAGHQQGQ-PASSSHHD-GA----GSVEPR-
A0A452ER54_BAD-02       --------KHWLTAPGLLGEAGHQQGQ-PAGSSHHG-GT----GAVETR-
W5P8G9_BAD-01           --------KHWLTAPGLLGEAGHQQGQ-PAGSSHHG-GT----GAVETR-
G3TP47_BAD-01           --------DRHRVAPGFLRDSSHQQGQ-PTSSGHHG-GA----AAVETR-
G1MI17_BAD-01           --------KHRQTAPGLLGEAAHPQGQ-PASSNHHG-GA----GAVEPR-
A0A287AEF3_BAD-01       --------QPWRTAPGHLGEAGHQQGQ-PASSSHHG-GA----GAVETR-
M3YNE7_BAD-01           --------KHLQTAPGLLGEAGHQQGQ-PASSSHHG-GA----GAVETR-
A0A452RJM6_BAD-01       --------KHRQTAPGLLGEAAQPQGQ-PASSNHHG-GA----GAVEPR-
A0A384DJL2_BAD-01       --------KHRQTAPGLLGEAAHPQGQ-PASSNHHG-GA----GAVEPR-
A0A452ER54_BAD-01       --------------PGLLGEAGHQQGQ-PAGSSHHG-GT----GAVETR-
F1MUT9_BAD-01           --------KHWLTAPGLLGEAGHQQGQ-PAGSSHHG-GT----GAVETR-
Q3SYZ0_BAD-01           --------KHWLTAPGLLGEAGHQQGQ-PAGSSHHG-GT----GAVETR-
F7DN67_BAD-01           --------RHQRTAPGLLGEAGHQQGQ-PASSSHHG-GA----GAVETR-
O35147_BAD-01           ----------PYLAPGLLGSIVQQQPGQAANNSHHG-GA----GTMETR-
H0WVR2_BAD-01           --------KNRCTTPSLLGDASHLQGQ-PASNTHHGAGP----GAVETR-
H0V608_BAD-01           ------------PAGGFLGDTSHQQRQLRSSRSHHG-GT----VAMETR-
A0A2K5E6K7_BAD-01       --------KHPRQAPGLPGDASHQQGQ-PTSSSHHG-GA----GAVETR-
A0A2K6TG62_BAD-01       --------KHRRQAPGLPGDASHQQGQ-PTSSSHHG-GA----GAVETR-
A0A0D9R491_BAD-01       --------KHHHQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVETR-
A0A2K5M0C1_BAD-01       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVETR-
A0A2K5VCD8_BAD-01       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVETR-
F7GVS7_BAD-01           --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVETR-
A0A2K6E7J3_BAD-01       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVETR-
A0A2K5XJR2_BAD-01       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVETR-
A0A2I3MCN5_BAD-04       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVETR-
A0A2K6N1A1_BAD-01       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVETR-
A0A2K6PUM5_BAD-01       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVETR-
A0A2K5HKW9_BAD-01       --------KHHRQAPGLLWDASHQQEQ-ATSSSHHG-GA----GAVETR-
B4DZQ9_BAD-01           --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVEIR-
A0A2K6GWV0_BAD-01       --------KHPCTAPSFLGDASHQQGQ-PSSSSHHG-GA----GSVETR-
F6SJL0_BAD-01           --------KHRRQAPGLPGDASHQQGQ-STSSSHHG-GA----GAVETR-
A0A2I3MCN5_BAD-01       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVETR-
A0A2I2Z8C7_BAD-02       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVEIR-
A0A2I2Z8C7_BAD-01       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVEIR-
Q92934_BAD-01           --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVEIR-
Q92934_BAD-02           --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVEIR-
A0A2I3TBK7_BAD-02       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVEIR-
A0A2R8Z697_BAD-01       --------KHHRQAPGLLWDASHQQEQ-PTSSSHHG-GA----GAVEIR-
A0A2J8TYJ3_BAD-01       --------KHHRQAPGLLRDASHQQEQ-PTSSSHHG-GA----GAVEIR-
F1PK10_BAD-01           --------KHQQTAPGLLGEAGHQQGQ-PASRKHHG-GA----GA-ETR-
Q45KI9_BAD-01           --------KHQQTAPGLLGEAGHQQGQ-PASRKHHG-GA----GA-ETR-
I3MBM5_BAD-01           ----------CGLAPGLPRDTGHQQWQ-ATSSSNHG-GA----GATETR-
I3MBM5_BAD-02           ----------CGLAPGLPRDTGHQQWQ-ATSSSNHG-GA----GATETR-
Q61337_BAD-05           ----------PYLAPGLLGSNIHQQGR-AATNSHHG-GA----GAMETR-
Q61337_BAD-04           ----------PYLAPGLLGSNIHQQGR-AATNSHHG-GA----GAMETR-
Q61337_BAD-03           ----------PYLAPGLLGSNIHQQGR-AATNSHHG-GA----GAMETR-
Q61337_BAD-06           ----------PYLAPGLLGSNIHQQGR-AATNSHHG-GA----GAMETR-
Q61337_BAD-02           ----------PYLAPGLLGSNIHQQGR-AATNSHHG-GA----GAMETR-
Q61337_BAD-01           ----------PYLAPGLLGSNIHQQGR-AATNSHHG-GA----GAMETR-
I3LVX0_BIK-01           --------------------------------------------------
A0A3G3M2M0_BCL2L11      ---------------RGGIAMSNSHQSRSPMSRTFS---RSSSGYFSVD-
A0A3Q1ELG4_BCL2L11      ---------------SPSWSR--ASLGVFQTRSIFHLPRRSSSGYFSADG
A0A3Q1CI15_BCL2L11      ---------------SPSWSRAQASLGVFQTRSIFHLPRRSSSGYFSADG
O61667_EGL1-01          --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
F6TGJ4_BMF-01           --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
I3MDS9_BMF-02           --------------------------------------------------
A0A287AIU8_BMF-05       --------------------------------------------------
A0A287AIU8_BMF-04       --------------------------------------------------
A0A287AIU8_BMF-03       --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A2K5KGR6_BMF-01       --------------------------------------------------
A0A2K6FFR1_BMF-02       --------------------------------------------------
M3WRS0_BMF-02           --------------------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
F7HPK0_BMF-02           --------------------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
G3QIN5_BMF-02           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
G7PAW6_BMF-01           --------------------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A2AV74_BMF-01           --------------------------------------------------
Q8K589_BMF-01           --------------------------------------------------
I3MDS9_BMF-01           --------------------------------------------------
G3T7Z4_BMF-01           --------------------------------------------------
F6X3N6_BMF-01           --------------------------------------------------
G3WDQ2_BMF-01           --------------------------------------------------
Q96LC9_BMF-06           --------------------------------------------------
F6TJI0_BMF-02           --------------------------------------------------
F6TJI0_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
J9PB65_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
M3WRS0_BMF-01           --------------------------------------------------
A0A2U4BC98_BMF-01       --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
A0A2K6FFR1_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A2K5MJY6_BMF-02       --------------------------------------------------
A0A2K5KGR6_BMF-02       --------------------------------------------------
G7PAW6_BMF-02           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5G4_BMF-01       --------------------------------------------------
A0A2K6B5G4_BMF-02       --------------------------------------------------
A0A2K6B5G4_BMF-04       --------------------------------------------------
A0A2K5Z4C3_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-03       --------------------------------------------------
A0A2K6L933_BMF-01       --------------------------------------------------
A0A2K6RAW8_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
F7HPK0_BMF-01           --------------------------------------------------
A0A2K5E1W9_BMF-01       --------------------------------------------------
A0A2K6TW86_BMF-02       --------------------------------------------------
A0A2K6TW86_BMF-01       --------------------------------------------------
G3QIN5_BMF-01           --------------------------------------------------
Q96LC9_BMF-01           --------------------------------------------------
Q96LC9_BMF-04           --------------------------------------------------
Q96LC9_BMF-03           --------------------------------------------------
Q96LC9_BMF-02           --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
H9GL49_BMF-01           --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
A9XRG9_BMF-01           --------------------------------------------------
A9XRG9_BMF-02           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
H0ZMX5_BMF-01           --------------------------------------------------
A9XRG9_BMF-03           --------------------------------------------------
A9XRG9_BMF-04           --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2E3E8_BMF-02       --------------------------------------------------
A0A3Q2E3E8_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-04       --------------------------------------------------
A0A3B3I0V9_BMF-02       --------------------------------------------------
A0A3B3I0V9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-03       --------------------------------------------------
A0A3P9JM16_BMF-03       --------------------------------------------------
A0A3P9JM16_BMF-02       --------------------------------------------------
A0A3P9JM16_BMF-01       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3LME3_BMF-01       --------------------------------------------------
A0A3Q3LME3_BMF-02       --------------------------------------------------
A0A3Q3LME3_BMF-03       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3B5KWG6_BMF-01       --------------------------------------------------
A0A286XF37_PMAIP1-      ------------------------------------------LNSLGCT-
Q9JM54_PMAIP1-01        KVYCTWSAPDITVVLAQMPGK----------------SQKSRM--RSPS-
Q5U777_PMAIP1-01        KVYCTWSAPDITAVLAQMPGK----------------KSRKSTMRRSPS-
F1SMU1_PMAIP1-01        ------------------------------GARVRGLSSRSFAAKFRLL-
A0A3B3QC78_BCL2L11      --------------------------------PRFSTLSASSSGYHSLD-
A0A3Q2U844_BCL2L11      --------------SPGSPGPFAIRSPLFFFVRRSPLLPRSSSGYFSFE-
G3SU55_BCL2L11-01       GDSCPQGSPQGPQAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
G3W979_BCL2L11-01       GDSCSPSSPQGPFAPPTSPSPFATRSPLFIFVRRSPLLPRSSSGYFSFD-
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------SVFHTRSIFQLPRRSSSGYFSSD-
A0A2K5JY52_PMAIP1-      --SSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLL-
A0A096MPU8_PMAIP1-      -SSSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLL-
A0A2K5ZWH1_PMAIP1-      -SSSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLL-
A0A2K5VPX2_PMAIP1-      -SSSPLVLPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLL-
A0A2K6BV75_PMAIP1-      -SSSPLVLPRGHEEQVQVARSRVCYSTQEIWRQTKLPAETSESDSQTLL-
A0A2K6KJF2_PMAIP1-      -SSSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETFESDSQTLL-
A0A2K6NC45_PMAIP1-      -SSSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETFESDSQTLL-
Q13794_PMAIP1-02        LSSSPLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLL-
A0A2R9AKC9_PMAIP1-      -SSSPLALPRGHEEQAQVAGSRVCYSTQEIWRQTELPAETSESDIQTLL-
A0A1D5QGJ8_PMAIP1-      ----PLVLPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLL-
A0A2I2YVQ5_PMAIP1-      ----PLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLL-
A0A2I3SX38_PMAIP1-      LSSWPLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLL-
C1C3S9_BAD-01           ETRQRTESASEASETDSVG-----ELQHFRSRSRSAPSSLMVAARYGRE-
A0A3B4CPH6_BAD-01       KKYGRQLRKMSD-EFDTLLDKGMKRVRSAGAARQMHASPSWFTFLWSHK-
F6Z067_BAD-01           PGKESRLRTESASESSETD-----KVGELHPFRSRSRSAPSSMIATKYG-
A0A3Q2LHE3_BIK-01       DSVAMRLAFIGD-EMEVRW-----MLPHIAELPGVAVYSLAFTY---NQ-
A0A452QUG1_BIK-01       DDVAMRLAFIGD-EMEVRW-----MLPRVGELPGMAMYSLAFTY---NQ-
A0A452V3L2_BIK-01       DDVAMRLAFIGD-EMEVRW-----MLPRVGELPGMAMYSLAFTY---NQ-
M3XHJ5_BCL2L11-01       LSKVIALVRWRDRSLLSTL-----MGGLLLPPSPCPFVTRSPFFIFMRR-
W5QCU2_BIK-01           HYLAMQLASIAD-EMELRL-----LLPQFVEPFWMPMYSLCFPY---SH-
O70337_BIK-04           NQVALRLACIGD-EMDLCL-----RSPRLVQLPGIAIHRLAVTY---SR-
O70337_BIK-01           NQVALRLACIGD-EMDLCL-----RSPRLVQLPGIAIHRLAVTY---SR-
O70337_BIK-02           NQVALRLACIGD-EMDLCL-----RSPRLVQLPGIAIHRLAVTY---SR-
Q925D2_BIK-01           NQVALRLACIGD-EMDRCL-----RSPRLVQLPGIAMHRLAATY---SQ-
G1TZR9_BIK-01           NQVALRLAYIGD-EMDLHV-----RGLHTGPAAGVAMHS--LAFTYSQT-
H0W025_BIK-01           SLVALRLACIGD-EMDLRL-----RSPRLAQLPGRAVHSLAITY---SQ-
A0A2K5CLG5_BIK-01       DALVLQLACIAD-QMDVSL-----RARRLAQLYEVAMYSPGLAFILDRT-
F7FUT7_BIK-01           DALALQLACIAD-QMDVSL-----RARRLAQLYEVAMYSPGLAFVLDRT-
A0A2K6TBD7_BIK-01       DALALQLACIAD-QMDVSL-----RARRLAQLYEVATYSPGLAFILDRT-
H2P4N6_BIK-01           DALALRLACIGD-EMDVSL-----RAPRRAQLPEVAMHSLGLAFIYDQT-
G1S1X2_BIK-01           DALAPRLACIGD-EMDVSL-----RAPRLAQLSEVAMHSLGLAFIYDQT-
G3QCT2_BIK-01           DALALRLACIGD-EMDVSL-----RAPRLAQLSEVAMHSLGLAFIYDQT-
A0A2R8ZXD2_BIK-01       DALALRLACIGD-EMDVSL-----RAPRLAQLSDVAMHSLGLAFIYDQT-
H2QLU7_BIK-01           DALALRLACIGD-EMDVSL-----RAPRLAQLSDVAMHSLGLAFIYDQT-
Q13323_BIK-01           DALALRLACIGD-EMDVSL-----RAPRLAQLSEVAMHSLGLAFIYDQT-
A0A2K6MCW0_BIK-01       DMLALRLACIGD-EMDVSL-----RAPRLAQLSEVAMHSLGLAFIYDQT-
A0A2K6QK74_BIK-01       DMLALRLACIGD-EMDVSL-----RAPRLAQLSEVAMHSLGLAFIYDQT-
A0A0D9QZY8_BIK-01       DMLALRLACIGD-EMDVSL-----RAPRLAQLSEVAMHSLGLAFIYDQT-
A0A2K5VW94_BIK-01       DMLALRLACIGD-EMDVSL-----RAPRLAQLSEVAMHSLGLAFIYDQM-
A0A2K6DBJ4_BIK-01       DMLALRLACIGD-EMDVSL-----RAPRLAQLSEVAMHSLGLAFIYDQM-
A0A2K5J4Q7_BIK-01       DMLALRLACIGD-EMDVSL-----RAPRLAQLSEVAMHSLGLAFIYDQT-
A0A096NKG5_BIK-01       DMLALRLACIGD-EMDVSL-----RAPRLAQLSEVAMHSLGLAFIYDQT-
A0A2K5LDM6_BIK-01       DMLALRLACIGD-EMDVSL-----RAPRLAQLSEVAMHSLGLAFICDQT-
A0A2K5XSA1_BIK-01       DMLALRLACIGD-EMDVSL-----RAPRLAQLSEVAMHSLGLAFIYDQT-
F1PUF4_BIK-01           DDVAMRLAFIGD-EMEVRW-----MLPRVGELPGMAMYSLA--FTYNQT-
H0XAE7_BIK-01           DQVALRLACIGD-EMDLHL-----RSPRLAQLSRMTMHSLG--LSYNQT-
A0A2K6FM79_BIK-01       DEVALRLACIGD-EMDLCL-----RSPRLAWLPGMTMHSLGLALSCDQP-
A0A3P8XIA2_BCL2L11      --------------------------------------STSSSGYFSFD-
F7G1G0_HRK-01           ----------------------------------AAQLTAARLKALGDE-
P62816_HRK-03           ----------------------------------AAQVTALRLQALGDE-
P62817_HRK-01           ----------------------------------AAQVTALRLQALGDE-
A0A287A5N9_HRK-01       ----------------------------------AAQLTAARLKALGDE-
H2NIS8_HRK-01           ----------------------------------AAQLTAARLKALGDE-
A0A2K5KZ69_HRK-01       ----------------------------------AAQLTAARLKALGDE-
H2Q6Y8_HRK-01           ----------------------------------AAQLTAARLKALGDE-
G3UH24_HRK-01           ----------------------------------AAQLTAARLKALGDE-
A0A2K5BYA0_HRK-01       ----------------------------------AAQLTAARLKALGDE-
U3E722_HRK-01           ----------------------------------AAQLTAARLKALGDE-
A0A452DXE5_HRK-01       ----------------------------------AAQLTAARLKALGDE-
A0A0D9SC73_HRK-01       ----------------------------------AAQLTAARLKALGDE-
A0A3Q2IBL3_HRK-01       ----------------------------------AAQLTAARLKALGDE-
A0A337SQ56_HRK-01       ----------------------------------AAQLTAARLKALGDE-
G3QTJ6_HRK-01           ----------------------------------AAQLTAARLKALGDE-
O00198_HRK-01           ----------------------------------AAQLTAARLKALGDE-
A0A1D5R1E4_HRK-01       ----------------------------------AAQLTAARLKALGDE-
A0A2K6AYL7_HRK-01       ----------------------------------AAQLTAARLKALGDE-
G1QHD8_HRK-01           ----------------------------------AAQLTAARLKALGDE-
G1T7W1_HRK-01           ----------------------------------AAQLTAARLKALGDE-
H0Y001_HRK-01           ----------------------------------AAQLTAARLKALGDE-
A0A096N944_HRK-01       ----------------------------------AAQLTAARLKALGDE-
A0A2K6GL98_HRK-01       ----------------------------------AAQLTAARLKALGDE-
E2RLD4_HRK-01           ----------------------------------AAQLTAARLKALGDE-
F7GVS7_BAD-04           -------------------------------GRELRRMSDEFVDSFKVS-
Q2PG01_BAD-01           -------------------------------GRELRRMSDEFVDSFK---
A0A2I3H4B2_BAD-01       -------------------------------GRELRRMSDEFVDSFK---
A0A452IFQ4_BAD-01       SRSAP---------------------PILWAAMRYGRELRRMSDEFDVA-
K7GA86_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
Q4KMV9_BCL2L11-01       GGSSSASTPWGPTISPYSPSSFVNRSPHCMLVRGSSLVSKTSSGYFSF--
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      -------------------GPFATRSP-----------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-03       --------------------------------------------------
A0A452FCS1_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       GDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
F7CXT2_BCL2L11-01       GDSCSPSSPQGPFAPPTSPSPFATRSPLFIFLRRSPLLPRSSSGYFSFD-
O54918_BCL2L11-01       GDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
O88498_BCL2L11-01       GDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
A0A337SW42_BCL2L11      GDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFD-
A0A337SW42_BCL2L11      GDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFD-
A0A2K5NU92_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5HZI7_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I2YQ13_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
O43521_BCL2L11-24       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
O43521_BCL2L11-08       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5X2I7_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
F7HHA9_BCL2L11-03       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6E226_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5Z8B6_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I3HW02_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2R9CA99_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2J8JCT2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I3M6I1_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6KJP8_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6QIL2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5CAB2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
F6XMC1_BCL2L11-06       GDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K6TRZ5_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K5CAB2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K6TRZ5_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K5CAB2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
F6XMC1_BCL2L11-04       GDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K6TRZ5_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K5NU92_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I2YQ13_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
O43521_BCL2L11-18       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5X2I7_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
F7HHA9_BCL2L11-01       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6E226_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5Z8B6_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I3HW02_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2R9CA99_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2J8JCT2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I3M6I1_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6KJP8_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6QIL2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5NU92_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5HZI7_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I2YQ13_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
O43521_BCL2L11-16       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
O43521_BCL2L11-12       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5X2I7_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
F7HHA9_BCL2L11-06       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6E226_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5Z8B6_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I3HW02_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2R9CA99_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2J8JCT2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I3M6I1_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6KJP8_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6QIL2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5HZI7_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6GE31_BCL2L11      GDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
A0A2K6GE31_BCL2L11      GDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
F6XMC1_BCL2L11-08       GDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K6GE31_BCL2L11      GDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
A0A2K6GE31_BCL2L11      GDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
A0A287DFJ0_BCL2L11      GDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
A0A286XJN2_BCL2L11      GDRSPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
A0A286XJN2_BCL2L11      GDRSPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
A0A2K5CAB2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
F6XMC1_BCL2L11-07       GDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K6TRZ5_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
F6XMC1_BCL2L11-05       GDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K6TRZ5_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K5CAB2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K5NU92_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5HZI7_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5X2I7_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
F7HHA9_BCL2L11-02       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6E226_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5Z8B6_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I3M6I1_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6KJP8_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6QIL2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I2YQ13_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
O43521_BCL2L11-09       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
O43521_BCL2L11-21       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2R9CA99_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2J8JCT2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5NU92_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5HZI7_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5X2I7_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
F7HHA9_BCL2L11-04       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6E226_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5Z8B6_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I3M6I1_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6KJP8_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6QIL2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I2YQ13_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
O43521_BCL2L11-20       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I3HW02_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2R9CA99_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2J8JCT2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5CAB2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K5CAB2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
F6XMC1_BCL2L11-03       GDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K6TRZ5_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K6TRZ5_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-
A0A2K6QIL2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6QIL2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5NU92_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5HZI7_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5X2I7_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6E226_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6E226_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K5Z8B6_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I3M6I1_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6KJP8_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2K6KJP8_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I2YQ13_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
O43521_BCL2L11-03       GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2I3HW02_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2R9CA99_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A2J8JCT2_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-
A0A337SW42_BCL2L11      GDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFD-
A0A452FCS1_BCL2L11      GDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
W5PY58_BCL2L11-01       GDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
Q2YDF0_BCL2L11-02       GDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
F1SU81_BCL2L11-02       GDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
G1SSY0_BCL2L11-01       GDRCAHGSPQGPLAPSASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
H0XW23_BCL2L11-01       GDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
A0A337SW42_BCL2L11      GDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFD-
G1LDR8_BCL2L11-01       GDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
J9NWV6_BCL2L11-01       GDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
F1SU81_BCL2L11-01       GDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-
                                                                          

A0A287AZR7_PMAIP1-      ---------LSKETFMAKGKVLFASMPHRSSN-KNTQTNPLRLALPPL--
G1MV54_BCL2L11-01       ----------------------------FLLC-AASRWRSHSLAEEIQ--
G1PDJ5_BCL2L11-01       -----------------------------------SMQQSQALPVDMR--
A0A452J430_PMAIP1-      -------------------------MPGKTLR-KGAQQNPALPAQEAV--
A0A1D5PAR2_PMAIP1-      ------------------------MMPGRTIR----KPAPPAAPAERD--
A0A2K6EM90_PMAIP1-      -------------------------MPVKKAR-KNAQPSPTRTRAEIE--
G1P8F9_PMAIP1-01        -------------------------MPGKKAR-KNAQPSPTRAPAEAE--
Q9JM54_PMAIP1-03        -------------------------MPGKSQKSRMRSPSPTRVPADLK--
A0A3Q2I0H2_PMAIP1-      -------------------------MPTRKAR-KSGQPSPTRAPAELE--
G3T0P7_PMAIP1-01        -------------------------MPGKKAR-KSAQPGPAGTPAGTQQR
Q1PCT2_PMAIP1-01        -------------------------MPGRKAR-KSAQPGPTRAPEELE--
G1LIZ7_PMAIP1-01        -------------------------MPGKKAR-KSAQASPARTRGQPE--
A0A452STA4_PMAIP1-      -------------------------MPGKKAR-KSAQASPARTPAEPE--
A0A2K5NJZ2_PMAIP1-      -------------------------MPGKKAR-KNAQPSPMRAQAELE--
A0A0D9S003_PMAIP1-      -------------------------MPGKKAR-KNAQPSPTRAQAELE--
A0A2K5VPX2_PMAIP1-      -------------------------MPGKKAR-KNAQPSPTRAQAELE--
A0A2K6BV75_PMAIP1-      -------------------------MPGKKAR-KNAQPSPTRAQAELE--
A0A2K5ZWH1_PMAIP1-      -------------------------MPGKKAR-KNAQPSPTRAQAELE--
A0A096MPU8_PMAIP1-      -------------------------MPGKKAR-KNAQPSPTRAQAELE--
A0A2K5JY52_PMAIP1-      -------------------------MPGKKAR-KNAQPSPARAQAELE--
A0A2K6KJF2_PMAIP1-      -------------------------MPGKKAR-KNAQPSPARAQAELE--
A0A2K6NC45_PMAIP1-      -------------------------MPGKKAR-KNAQPSPARAQAELE--
A0A2K6S6C4_PMAIP1-      -------------------------MPGKKAR-KSAQPSPARAPADLE--
A0A2I2YVQ5_PMAIP1-      -------------------------MPGKKAR-KNAQPSPARAPAELE--
Q13794_PMAIP1-01        -------------------------MPGKKAR-KNAQPSPARAPAELE--
A0A2R9AKC9_PMAIP1-      -------------------------MPGKKAR-KNAQPSPARAPAELE--
A0A2I3SX38_PMAIP1-      -------------------------MPGKKAR-KNAQPSPARAPAELE--
H2NWG2_PMAIP1-01        -------------------------MPGKKAR-KNAQPSPARAPAELE--
A0A2K5CFK7_PMAIP1-      -------------------------MPGKKAR-KSAQPSPSRAPADLE--
F7GW45_PMAIP1-01        -------------------------MPGKKAR-KSAQPSPARAPADLE--
A0A337SUX1_PMAIP1-      -------------------------MPGKRTR-KSAQPSPARAPAEPE--
A0A3Q1NFP6_PMAIP1-      -------------------------MPGRRAR-KSAQPSPTRVPADPE--
A0A452EST2_PMAIP1-      -------------------------MPGRRAR-RSAQPSPTRVPADPE--
W5P738_PMAIP1-01        -------------------------MPGRRAR-RSAQPSPTRVPADPE--
Q9JM54_PMAIP1-02        -------------------------MPGRKAR-RNAPVNPTRA--DLK--
A0A2I3HX97_PMAIP1-      --------------------------KPGRAR-RNAQPSPAPAPAELE--
A0A452TE71_PMAIP1-      -------------------------WGSLLSG-EPASPSPSAAPPP-E--
A0A0P0HZF9_PMAIP1-      -------------------------------------------MAKKEKT
Q0GKC8_PMAIP1-01        -------------------------------------------MAKKEQT
Q6JTU4_BCL2L11-01       ----------------------------------------MRQAEPADMR
A0A3B5RFA9_PMAIP1-      ------------------------------------------LPAAAEL-
K7E5Y2_BBC3-01          SSLLPLAYFCTRQPRAY-----------GGPRWARAARSPAAGNQGQSGS
A9XRH0_BMF-01           --------------------------------IADQFHRLHIQRHQQNRN
R4G9R5_BCL2L11-01       ---------------------------------SHCPRRGFLDYQAVNHQ
A3KND0_BMF-01           ------------IMLPC--------------GVSETPQRLFYGKEALSEI
Q6P7C5_BAD-01           --------------QPG--------------QAANNSHH---GGRFLTSI
A0A287AEF3_BAD-02       SRPAAATMEALGLWRPG--------------VATALTQR---GPRRMKGL
Q9BXH1_BBC3-04          TQGPQSPRDGAQLGACT---RPVD----VRDSGGRPLPPPDTLASA----
A0A2K5F6X4_BBC3-02      -GPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A337SQV0_BBC3-03      --PQPSLSPAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A3P8RLE2_BCL2L11      RSSSGYFSADGADSVPS---SPLS----PKRLTADKATQTPSPSGQVI--
A0A3B1JLM2_BAD-01       QVYNINRWEDNENQDGA--SAEDGGVGDGAPFRGRSQSAPAALWK-----
A0A3Q2LHE3_BIK-02       RSPEALEVPGMTELTES---SPDSDNRDSVAMRLAFIGDEMEVRWMLPHI
E7FBJ6_BAD-01           -QDTETQD--GASVEEN-----GD----GLPFRGRSQSAPAALWK-----
B5XEF1_BAD-01           -EDTEFQDVMTPTEEGG-----GD----GASFRGRSQSAPPALWA-----
H3D8J8_BAD-01           ----ELQGNGDD--EAG---TPTD----GAPFRGRSRSAPPALWA-----
A0A3B5L9R9_BAD-01       -TKVELQARGEE--EVG---TPTE----GFPFRGRSLSAPPSLWA-----
Q9GL49_PMAIP1-01        ----PAAVRGNQPTSEAFGRSGCC-FSSSLPLARFCPTAPRAACY-----
A0A3B1IH05_BAD-01       -LQESGAGRHED--------GARD----GDSFRRRSRSAPPSLWA-----
A0A3Q2QC80_BAD-01       ----ELQGRAEE--EAG---TPTE----GLPFRNRSNSAPPALWA-----
A0A3Q3MLA0_BAD-02       ----ELQARGEE--EAG---TPTE----GAPFRGRSKSAPPALWA-----
A0A3Q3MLA0_BAD-03       ----ELQARGEE--EAG---TPTE----GAPFRGRSKSAPPALWA-----
I3K7B6_BAD-01           ----DLMARGED--EVC---TPTE----GDPFRRRSKSAPPALWA-----
A0A3P9B2E4_BAD-01       ----ELMARGED--EVC---TPTE----GDPFRRRSKSAPPALWA-----
A0A3Q3C680_BAD-01       ----ELMARGED--EVC---TPTE----GDPFRRRSKSAPPALWA-----
A0A3P8QRJ7_BAD-01       ----ELMARGED--EVC---TPTE----GDPFRRRSKSAPPALWA-----
A0A3Q4GGN3_BAD-01       ----ELMARGED--EVC---TPTE----GDPFRRRSKSAPPALWA-----
A0A3B4GXJ6_BAD-01       ----ELMARGED--EVC---TPTE----GDPFRRRSKSAPPALWA-----
A0A3Q2D5S0_BAD-01       ----E--ARGEE--EVG---TPTE----GYPFRGRSNSAPPALWA-----
A0A3B3BQF7_BAD-01       ----DLPR--ED--EAG---TPTD----GLAFRGRSKSAPPALWA-----
A0A3Q1K1C7_BAD-02       ----ELQAKADE--EAG---TPTD----GAPFRARSKSAPPALWA-----
A0A3Q1K1C7_BAD-01       ----ELQAKADE--EAG---TPTD----GAPFRARSKSAPPALWA-----
A0A3Q1GWH9_BAD-01       ----ELQAKGEE--EAG---TPTE----GAPFRARSKSAPPALWA-----
A0A3Q1CPU7_BAD-01       ----ELQARGEE--EAG---TPTD----GAPFRARSKSAPPALWA-----
A0A3P8TWH6_BAD-01       ----ELQARGEE--EAG---TPTD----GAPFRARSKSAPPALWA-----
A0A2U9BAC9_BAD-01       ----ELLTRWDE--EAG---TPTD----GAPFRGRSKSAPPALWA-----
A0A3B4VFC5_BAD-01       ----EFQARGEE--EAG---TPTE----GAPFRGRSKSAPPALWA-----
A0A3B4W9T1_BAD-01       ----EFQARGEE--EAG---TPTE----GAPFRGRSKSAPPALWA-----
A0A3Q0QNQ2_BAD-01       ----ELVVRGED--EIC---TPTE----GDPFRRRSKSAPPALWA-----
A0A3P8WIZ8_BAD-02       ----AFQSWGEE--EAG---TPTE----GAPFRGRSRSAPPALWA-----
A0A3P8WIZ8_BAD-01       ----AFQSWGEE--EAG---TPTE----GAPFRGRSRSAPPALWA-----
A0A3P9A5G8_BAD-02       -DNTEFQVAMTPTEESG-----GD----AAPFRGRSQSAPPALWA-----
A0A3P9A5G8_BAD-01       -DNTEFQVAMTPTEESG-----GD----AAPFRGRSQSAPPALWA-----
B5X1T1_BAD-01           -DNTEFQDVMTPTEEGG-----GD----GAPFRSRSQSAPPTLWA-----
H3ANP3_BAD-03           -KRNNMEILGRP--SSESQISDSESLDELGPFRTRSRSAPPNFWA-----
H3ANP3_BAD-04           ---DNMEILGRP--SSESQISDSESLDELGPFRTRSRSAPPNFWA-----
H3ANP3_BAD-02           ---DNMEILGRP--SSESQISDSESLDELGPFRTRSRSAPPNFWA-----
H3ANP3_BAD-01           ---DNMEILGRP--SSESQISDSESLDELGPFRTRSRSAPPNFWA-----
A0A3B3QX41_BAD-01       -L--DFGEGGAS--EEGGGVCPGD----GTPFRGRSRSAPPALWA-----
Q4V925_BAD-02           ----NLSMNEEDLLETG---VAEDPHMLGDPFRPRSRSAPPALWA-----
Q4V925_BAD-03           ----NLSMNEEDLLETG---VAEDPHMLGDPFRPRSRSAPPALWA-----
A7MCM4_BAD-01           ----NLSMNEEDLLETG---VAEDPHMLGDPFRPRSRSAPPALWA-----
Q4V925_BAD-04           ----NLSMNEEDLLETG---VAEDPHMLGDPFRPRSRSAPPALWA-----
Q4V925_BAD-01           ----NLSMNEEDLLETG---VAEDPHMLGDPFRPRSRSAPPALWA-----
A0A3P8Y761_BAD-01       -RSGELQGLGQG--LNC---VATE----GLPFRVRSQSAPPALWA-----
A0A3B5K831_BAD-01       -E--ELQGNVED--EAG---TPTE----GAPFRGRSRSAPPALWA-----
A0A3B5Q2N7_BAD-01       -V--ELQARGEE--EVG---TPTE----GFPFRGRSLSAPPSLWA-----
A0A087X8P8_BAD-01       -E--ELQARGEE--EVG---TPTE----GFPFRGRSNSAPPSLWA-----
A0A3B3UA11_BAD-01       -E--ELQARGEE--EVG---TPTE----GFPFRGRSNSAPPSLWA-----
A0A3B3YFR1_BAD-01       -E--ELQARGEE--EVG---TPTE----GFPFRGRSNSAPPSLWA-----
A0A3P9Q7C3_BAD-01       -E--ELQARGEE--EVG---TPTE----GFPFRVRSNSAPPSLWA-----
A0A3B3HDU2_BAD-01       ------DLARED--EAG---TPTD----GLAFRGRSKSAPPALWA-----
A0A3B5BAL2_BAD-01       -E--ELQARGEE--EAG---TPTD----GAPFRGRSKSAPPALWA-----
A0A3Q3AEL8_BAD-02       -E--ELPARADD--EPG---TPTE----GYPFRGRSKSAPPALWA-----
A0A3Q3AEL8_BAD-01       -E--ELPARADD--EPG---TPTE----GYPFRGRSKSAPPALWA-----
G3Q8B3_BAD-01           ------EELWLD--ETG---TPTE----GAPFRVRSKSAPPALWA-----
A0A3Q2Y0E4_BAD-01       -E--EFQARVDE--EVG---TPTD----GAPFRGRSKSAPPVLWA-----
A0A3Q3R5S3_BAD-01       ------DAKSDE--EAG---TPTD----GAPFRGRSKSAPPALWA-----
A0A3Q3RXS8_BAD-02       -S--ESQSRVDE--EAG---TPTD----GAPFRGRSKSAPPALWA-----
A0A3Q3RXS8_BAD-01       -S--ESQSRVDE--EAG---TPTD----GAPFRGRSKSAPPALWA-----
A0A3Q0QNQ2_BAD-02       -E--ELVVRGED--EIC---TPTE----GDPFRRRSKSAPPALWA-----
A0A3Q3WTY4_BAD-01       -R--TLQVKGED--EAG---TPTD----GAPFRGRSKSAPPSLWA-----
A0A3B1JXK6_BCL2L11      PSSQVIIHALQRISEAR---GDAQ----SFELCPGPNHCPPHRAAAAGDM
A0A3B4BVX1_BCL2L11      PSSQVITHALQRIAEAR---GNAQ----TFELWPLYNHHPPHGAAPAGDM
A0A3B4BVX1_BCL2L11      SRSSSGYFSFESE--PS---SPL--------LT--------SPSLSVCST
A0A3B4BVX1_BCL2L11      SRSSSGYFSFESE--PS---SPL--------VTHSASTQTPSPSSQVITH
A0A3P8XIA2_BCL2L11      STSSSGYFSFDCDSIPS---SPL--------LRNNKSTQTPSPSSQVITH
A0A3Q1ICY2_BCL2L11      RRSSSGYFSYDSDSQPS---SPLS----PRPVTFDRATQTPSPTGQVMNH
A0A3Q3K6I5_BCL2L11      RRSSSGYFSNDSDSVPS---SPLS----PRPVTADKVTQTPSPSSQVMNH
A0A3B4V919_BCL2L11      RRSSSGYFSFDSDSLPS---SPLS----PRPATVERTTQTPSPTSQVMKH
A0A3B4XZH1_BCL2L11      RRSSSGYFSFDSDSLPT---SPLS----PRPATAERTTQTPSPTSQVMKH
A0A3Q3ESW6_BCL2L11      RRASSGYFSYDGDSLPS---SPLS----PRPLTADKATQTPSPSGQVMQH
A0A3Q2SZH6_BCL2L11      -RKSSGYFSFDCESLPS---TPLS----PHPLTADKATQTASPTGQVMNH
A0A3B3VNE0_BCL2L11      RRSSSGYFSFDCDSLPS---SPLS----PHPVTADKATQTPSPTGQVMNH
A0A3B3YII5_BCL2L11      RRSSSGYFSFDCDSLPS---SPLS----PHPVTADKATQTPSPTGQVMNH
A0A3B3YII5_BCL2L11      RRSSSGYFSFDCDSLPS---SPLS----PHPVTADKATQTPSPTGQVMNH
A0A3P9N073_BCL2L11      RRSSSGYFSFDCDSLPS---SPLS----PHPVTADKTTQTPSPTGQVMNH
A0A3Q3B113_BCL2L11      RRSSSGYFSFEGDSLPS---SPLS----PKPVTAEKATQTPSPTGQVMNH
A0A3B5M375_BCL2L11      RRSSSGYFSFDCDSLPS---SPLS----PHPVTADKATQTPSLTGQVMNH
A0A3B5QAM1_BCL2L11      RRSSSGYFSFDCDSLPS---SPLS----PHPVTADKATQTPSLTGQVMNH
A0A3B5QAM1_BCL2L11      RRSSSGYFSFDCDSLPS---SPLS----PHPVTADKATQTPSLTGQVMNH
A0A2I3HWI8_BBC3-03      C-------------------------------AGGPTQAAPGVRGEEEQW
A0A2K6FQZ3_BBC3-04      PGPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
Q9BXH1_BBC3-05          CGPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A2R9BZA9_BBC3-01      CGPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A2I3RGH5_BBC3-03      CGPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A2K5P2T8_BBC3-03      CGPQPSLLLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A2K5V8J3_BBC3-03      CGPQPSLLLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
F7FFP6_BBC3-03          CGPQPSLLLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A2K6ASP2_BBC3-03      CGPQPSLLLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A2I3N2Z9_BBC3-03      CGPQPSLLLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A2K6QZU4_BBC3-04      CGPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A2R8MW85_BBC3-03      CGPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A2K6STD6_BBC3-02      CGSQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
G3T2N1_BBC3-01          SGPQPSLSPAEQHLESP---V--------------PTQAAPGVRGEDEQW
M3Y0R3_BBC3-01          PGPQPSLSPAEPHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
Q99ML1_BBC3-02          DGPQPSLSPAQQHLESP---VPSA----PEALAGGPTQAAPGVRVEEEEW
Q80ZG6_BBC3-01          DGPQPSLSPAQQHLESP---VPSA----PEALAGGPTQAAPGVRVEEEEW
H0XQ00_BBC3-01          DGPQPSLLPAEQHLESP---VPST----PGALAGGPTQAAPEVRGEEEQW
A0A3Q2GWE8_BBC3-01      DGPQPSLLPAEQHLESP---VPSA----PGALEGGPTQAAPGVRGEEEQW
A0A3Q1LXZ6_BBC3-01      DGPQPSLSPAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A452E3G1_BBC3-01      DGPQPSLSPAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
J9NTK9_BBC3-01          DGPQPSLSPAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A337SQV0_BBC3-02      DGPQPSLSPAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
F1RM01_BBC3-01          DGPQPSLSPAEQHLESP---VPSA----PGALAGGPTQAAPGIRGEEEQW
A0A2K6FQZ3_BBC3-01      DGPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
Q9BXH1_BBC3-06          DGPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A2I3RGH5_BBC3-01      DGPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
H2NZD3_BBC3-01          DGPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A2K6QZU4_BBC3-01      DGPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A0D9S2H2_BBC3-01      DGPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
B4DQK3_BBC3-01          DGPQPSLSLAEQHLESP---VPSA----PGALAGGPTQAAPGVRGEEEQW
A0A3Q3MLA0_BAD-01       -SRDEELQARGEEEAGT---PTEG-----APFRGRSKSAPPALWA-----
G1SS60_BAD-01           -SRHSSYPADADDSEGA---EEEP-----SPFRGRSRSAPPNLWA-----
K7E5Y2_BBC3-02          EGGQEGEPQGASPMSGG---PPGV----LGPEHGDQGEQQ----------
A0A3B4DUY7_BAD-01       -SRWQDNEDGLLAEDGG---AGDG-----APFRGRSQSAPAALWK-----
A0A337SAW2_BAD-01       -SRHSSYPAGTEEDEGT---EEEE----PSPFRGRSRSAPPNLWA-----
A0A2I3TBK7_BAD-01       ERGHSNPDAAKLQLDAS---LPVL----VGSELGQG--------------
A0A2R8Z697_BAD-02       ERGHSNADAAKLQLDAS---LPVL----VGSELGQG--------------
A0A2I2Z8C7_BAD-03       ERRHSNADAAKLQLDAS---LPVL----VGSELGQG--------------
Q92934_BAD-03           ERGHSNADAAKLQLDAS---LPVL----VGSELGQG--------------
A0A2K5M0C1_BAD-02       ERGHSDADAAKLQLDAS---LPVL----VGSELGQG--------------
A0A2K5XJR2_BAD-02       ERGHSDADAAKLQLDAS---LPVL----VGSELGQG--------------
A0A2I3MCN5_BAD-03       ERGHSDADAAKLQLDAS---LPVL----VGSELGQG--------------
A0A2K5VCD8_BAD-02       ERGHSDADAAKLQLDAS---LPVL----VGSELGQG--------------
F7GVS7_BAD-02           ERGHSDADAAKLQLDAS---LPVL----VGSELGQG--------------
A0A2K6E7J3_BAD-02       ERGHSDADAAKLQLDAS---LPVL----VGSELGQG--------------
A0A2K5E6K7_BAD-02       ERGHSNADAAKLQLDAS---HPVL----VGSELGQG--------------
A0A2K6TG62_BAD-02       ERGHSNADAAKLQLDAS---HPVL----VGSELGQG--------------
A0A2K5E6K7_BAD-03       SASSSENPSARMLSKAS---AGMS----APATDS-----E----------
A0A2K5HKW9_BAD-02       ESEDSENPSARMLTEAS---AGMS----APATDSEAQHAE----------
A0A2K6N1A1_BAD-02       ESEDSENPSARMLAEAS---AGMS----APATDSEAQLAE----------
A0A2K6PUM5_BAD-02       ESEDSENPSARMLAEAS---AGMS----APATDSEAQLAE----------
A0A2K5M0C1_BAD-03       ESEDSENPSARMLAEAS---ARMS----APATDSEAQHAE----------
A0A2K5VCD8_BAD-03       ESEDSENPSARMLAEAS---ARMS----APATDSEAQHAE----------
F7GVS7_BAD-03           ESEDSENPSARMLAEAS---ARMS----APATDSEAQHAE----------
A0A2K5XJR2_BAD-03       ESEDSENPSARMLAEAS---ARMS----APATDSEAQLAE----------
A0A2I3MCN5_BAD-02       ESEDSENPSARMLAEAS---APMS----APATDSEAQHAE----------
A0A2K6E7J3_BAD-03       ESEDSENPSARMLAEAS---ARMS----APATDSEAQHAE----------
A0A2I2Z8C7_BAD-04       ESEDSENPSAGMLAEAS---AGMS----APAADSEAQHAE----------
Q92934_BAD-04           ESEDSENPSAGMLAEAS---AGMS----APAADSEAQHAE----------
A0A2I3TBK7_BAD-03       ESEDSENPSAGMLAEAS---AGMS----APAADSEAQHAE----------
A0A2R8Z697_BAD-03       ESEDSENPSAGMLAEAS---AGMS----APAADSEAQHAE----------
F6SJL0_BAD-02           -----ENPSVRMFSKAS---AGMS----APATDSEAQHTE----------
A0A2K6TG62_BAD-03       -----ENPSAKMLSKAS---AGMS----APATDSEAQHTE----------
G3VRY4_BAD-02           GSREASPEAEAEAEQSE---GEEE----RGLFRGRSSSAPPILWA-----
G3VRY4_BAD-01           GSREASPEAEAEAEQSE---GEEE----RGLFRGRSSSAPPILWA-----
G1P8C5_BAD-01           -SRHSSYPTGTEEDDDT---EEGE----PSPFRGRSRSAPPNLWA-----
A0A452ER54_BAD-02       -SRHSSYPAGPEDDEGT---EEED----LGPFRGRSRSAPPNLWA-----
W5P8G9_BAD-01           -SRHSSYPAGPEDDEGT---EEED----LGPFRGRSRSAPPNLWA-----
G3TP47_BAD-01           -SRHSSYPAGSDEAEGL---EEDP-----SPFRGRSLSAPPNLWA-----
G1MI17_BAD-01           -SRHSSYPAGTEEDEGL---EEEE----LSPFRGRSSSAPPNLCA-----
A0A287AEF3_BAD-01       -SRHSSYPEGTEEDEGT---EDEE----LSPFRGRSLSAPPILWA-----
M3YNE7_BAD-01           -SRHSSYPAGTEEDEGM---EEEE----LSPFRGRSRSAPPNLCA-----
A0A452RJM6_BAD-01       -SRHSSYPAGTEEDEGL---EEEE----LSPFRGRSSSAPPNLCA-----
A0A384DJL2_BAD-01       -SRHSSYPAGTEEDEGL---EEEE----LSPFRGRSSSAPPNLCA-----
A0A452ER54_BAD-01       -SRHSSYPAGPEDDEGT---EEED----LGPFRGRSRSAPPNLWA-----
F1MUT9_BAD-01           -SRHSSYRAGPEDNEET---EEED----LGPFRGRSRSAPPNLWA-----
Q3SYZ0_BAD-01           -SRHSSYRAGPEDNEET---EEED----LGPFRGRSRSAPPNLWA-----
F7DN67_BAD-01           -SRHSSYPEGTEDEGME---GEEP-----GPFRGRSRSAPPNLWA-----
O35147_BAD-01           -SRHSSYPAGTEEDEGM---EEEL-----SPFRGRSRSAPPNLWA-----
H0WVR2_BAD-01           -SRHSSYPAGTEEDEGI----EEP-----SPFRGRSRSAPPNLWA-----
H0V608_BAD-01           -SRHRSYPAGTEEEEGM---EEEL-----SPFRGRSRSAPPNLWA-----
A0A2K5E6K7_BAD-01       -SRHSSYPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
A0A2K6TG62_BAD-01       -SRHSSYPAGTEGDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
A0A0D9R491_BAD-01       -SRHSSYPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
A0A2K5M0C1_BAD-01       -SRHSSYPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
A0A2K5VCD8_BAD-01       -SRHSSYPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
F7GVS7_BAD-01           -SRHSSYPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
A0A2K6E7J3_BAD-01       -SRHSSYPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
A0A2K5XJR2_BAD-01       -SRHSSYPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
A0A2I3MCN5_BAD-04       -SRHSSYPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
A0A2K6N1A1_BAD-01       -SRHSSYPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
A0A2K6PUM5_BAD-01       -SRHSSYPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
A0A2K5HKW9_BAD-01       -SRHSSHPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
B4DZQ9_BAD-01           -SRHSSYPAGTEDDEGM---GEEP-----SPFRGRSRSAPPNLWA-----
A0A2K6GWV0_BAD-01       -SRHSSYPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
F6SJL0_BAD-01           -SRHSSYPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
A0A2I3MCN5_BAD-01       -SRHSSYPAGTEEDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
A0A2I2Z8C7_BAD-02       -SRHSSYPAGTEDDEGM---GEEP-----SPFRGRSRSAPPNLWA-----
A0A2I2Z8C7_BAD-01       -SRHSSYPAGTEDDEGM---GEEP-----SPFRGRSRSAPPNLWA-----
Q92934_BAD-01           -SRHSSYPAGTEDDEGM---GEEP-----SPFRGRSRSAPPNLWA-----
Q92934_BAD-02           -SRHSSYPAGTEDDEGM---GEEP-----SPFRGRSRSAPPNLWA-----
A0A2I3TBK7_BAD-02       -SRHSSYPAGTEDDEGM---GEEP-----SPFRGRSRSAPPNLWA-----
A0A2R8Z697_BAD-01       -SRHSSYPAGTEDDEGM---GEEP-----SPFRGRSRSAPPNLWA-----
A0A2J8TYJ3_BAD-01       -SRHSSYPAGTEDDEGM---GEEP-----SPFRGRSRSAPPNLWA-----
F1PK10_BAD-01           -SRHSSFPAGTDEDEGM---EEEE----LSPFRGRSSSAPPNLCA-----
Q45KI9_BAD-01           -SRHSSFPAGTDEDEGM---EEEE----LSPFRGRSSSAPPNLCA-----
I3MBM5_BAD-01           -SRHSSYPADTDLDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
I3MBM5_BAD-02           -SRHSSYPADTDLDEGM---EEEP-----SPFRGRSRSAPPNLWA-----
Q61337_BAD-05           -SRHSSYPAGTEEDEGM---EEEL-----SPFRGRSRSAPPNLWA-----
Q61337_BAD-04           -SRHSSYPAGTEEDEGM---EEEL-----SPFRGRSRSAPPNLWA-----
Q61337_BAD-03           -SRHSSYPAGTEEDEGM---EEEL-----SPFRGRSRSAPPNLWA-----
Q61337_BAD-06           -SRHSSYPAGTEEDEGM---EEEL-----SPFRGRSRSAPPNLWA-----
Q61337_BAD-02           -SRHSSYPAGTEEDEGM---EEEL-----SPFRGRSRSAPPNLWA-----
Q61337_BAD-01           -SRHSSYPAGTEEDEGM---EEEL-----SPFRGRSRSAPPNLWA-----
I3LVX0_BIK-01           -------------------------------HSLALSYSQARVTGVLRSL
A0A3G3M2M0_BCL2L11      SDSVPGSPLLPNISEAQDDQNDEVWFAEPSHQH-VQMAAPVG--------
A0A3Q1ELG4_BCL2L11      SDSVPSSPLSPKRLTAD--------------KT-TQTPSPSG--------
A0A3Q1CI15_BCL2L11      ADSVPSSPLSPKRLTAD--------------KA-TQTPSPSG--------
O61667_EGL1-01          -------------SSCE--------------DS-SQFADDSGFFDDSEIS
Q9BXH1_BBC3-03          -------------RPHP--------------AARCLPLRPHRPTRRH-RR
F6TGJ4_BMF-01           -------------DYED--------------KA-TQTLGSPSISQDI-ML
A0A452H3N6_BMF-01       -------------EQQD--------------KA-TQTLSPSSSTQDV-ML
G1PAU1_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A2AV74_BMF-02           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A286XXB0_BMF-03       -------------SQED--------------KA-TQTLSPSSPSQGV-ML
I3MDS9_BMF-02           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A287AIU8_BMF-05       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A287AIU8_BMF-04       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A287AIU8_BMF-03       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A287AIU8_BMF-01       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A287AIU8_BMF-02       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2K5KGR6_BMF-01       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2K6FFR1_BMF-02       -------------SQED--------------KA-TQTLSPASPSQGV-ML
M3WRS0_BMF-02           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2K5E1W9_BMF-02       -------------SQED--------------KA-TQTLSPASPSQGV-ML
F7HPK0_BMF-02           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2K6TW86_BMF-03       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2K6RAW8_BMF-02       -------------SQED--------------KA-TQTLGPASPSQGV-ML
G3QIN5_BMF-02           -------------SQED--------------KA-TQTLSPASPSQGV-ML
Q96LC9_BMF-07           -------------SQED--------------KA-TQTLSPASPSQGV-ML
Q96LC9_BMF-05           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2R9BS98_BMF-02       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2J8QDD5_BMF-01       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2K5MJY6_BMF-01       -------------SQED--------------KA-TQTLGPASPSQGV-ML
G7PAW6_BMF-01           -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2K6B5G4_BMF-03       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2K5Z4C3_BMF-02       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A096NTE9_BMF-03       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2I3HD83_BMF-01       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A2AV74_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
Q8K589_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
I3MDS9_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
G3T7Z4_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
F6X3N6_BMF-01           -------------GQED--------------KA-TQTLSPASPSQGV-ML
G3WDQ2_BMF-01           -------------GQED--------------KA-TQTLSPASPSQGV-ML
Q96LC9_BMF-06           -------------SQED--------------KA-TQTLSPASPSQGV-ML
F6TJI0_BMF-02           -------------SQED--------------KA-TQTLSPASPSQGV-ML
F6TJI0_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A286XXB0_BMF-02       -------------SQED--------------KA-TQTLSPSSPSQGV-ML
J9PB65_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A286XXB0_BMF-01       -------------SQED--------------KA-TQTLSPSSPSQGV-ML
G1SR62_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
W5QFV1_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
Q05KI3_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
Q05KI3_BMF-02           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A452F2E0_BMF-02       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A452F2E0_BMF-01       -------------SQED--------------KA-TQTLSPASPSQGV-ML
M3WRS0_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2U4BC98_BMF-01       -------------SQED--------------KA-TQTLSPASPSQGV-ML
M3YAD5_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A452SED0_BMF-01       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A384D070_BMF-01       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2K6FFR1_BMF-01       -------------SQED--------------KA-TQTLSPASPSQGV-ML
H0WYH6_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A096NTE9_BMF-01       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2K6L933_BMF-02       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A096NTE9_BMF-02       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2K5MJY6_BMF-02       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2K5KGR6_BMF-02       -------------SQED--------------KA-TQTLGPASPSQGV-ML
G7PAW6_BMF-02           -------------SQED--------------KA-TQTLGPASPSQGV-ML
F7CM09_BMF-02           -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2K6B5G4_BMF-01       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2K6B5G4_BMF-02       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2K6B5G4_BMF-04       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2K5Z4C3_BMF-01       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2K6L933_BMF-03       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2K6L933_BMF-01       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A2K6RAW8_BMF-01       -------------SQED--------------KA-TQTLGPASPSQGV-ML
A0A0D9R4R5_BMF-01       -------------SQED--------------KA-TQTLGPASPSQGV-ML
F7HPK0_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2K5E1W9_BMF-01       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2K6TW86_BMF-02       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2K6TW86_BMF-01       -------------SQED--------------KA-TQTLSPASPSQGV-ML
G3QIN5_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
Q96LC9_BMF-01           -------------SQED--------------KA-TQTLSPASPSQGV-ML
Q96LC9_BMF-04           -------------SQED--------------KA-TQTLSPASPSQGV-ML
Q96LC9_BMF-03           -------------SQED--------------KA-TQTLSPASPSQGV-ML
Q96LC9_BMF-02           -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2R9BS98_BMF-01       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2J8QDD5_BMF-02       -------------SQED--------------KA-TQTLSPASPSQGV-ML
A0A2J8T301_BMF-01       -------------SQED--------------KA-TQTLSPASPSQGV-ML
H9GL49_BMF-01           -------------RQQD--------------KA-TQTLNPSSSSQDV-ML
K7FRX2_BMF-01           -------------EQQD--------------KA-TQTLSPSSSTQDV-ML
A9XRG9_BMF-01           -------------EQQD--------------KA-TQTLSPSSSSQDV-ML
A9XRG9_BMF-02           -------------EQQD--------------KA-TQTLSPSSSSQDV-ML
U3JS06_BMF-01           -------------EQQD--------------KA-TQTLSPSSSSQDV-ML
H0ZMX5_BMF-01           -------------EQQD--------------KA-TQTLSPSSSSQDV-ML
A9XRG9_BMF-03           -------------EQQD--------------KA-TQTLSPSSSSQDV-ML
A9XRG9_BMF-04           -------------EQQD--------------KA-TQTLSPSSSSQDV-ML
G1NHG8_BMF-01           -------------EQQD--------------KA-TQTLSPSSSSQDV-ML
A0A3B4UNJ0_BMF-01       -------------KYED--------------RA-TPIAAG--------QA
B2KKY9_BCL2L11-01       --------------------------------G-PASQGSGESTGGGVVL
B8JK68_BCL2L11-01       --------------------------------G-PASQGSGESTGGGVVL
A0A3B4B6Y3_BMF-01       -------------KCED--------------RA-TQTPGPALAPNKG-ML
Q0GKC7_BMF-01           -------------K------------------Q-TELAGRPAGSRNG-ML
A0A3B3RH63_BMF-01       -------------KCEN--------------RG-TQTPGPALVQGLN-ML
W5N4P7_BMF-01           -------------KYED--------------KG-TQTPSPALVHGDN-ML
A0A3B1K1X5_BMF-01       -------------KQEE--------------RG-TQTPGRPPARTNG-ML
A0A3B4CNJ8_BMF-01       -------------KQEE--------------RG-TQTPGRPPARPNG-ML
A0A2U9CJH3_BMF-01       -------------KCED--------------RG-TQTPGPALALNNG-ML
A0A3Q2YCX7_BMF-01       -------------KCEE--------------RA-TQTPGPVPASNNG-ML
A0A3Q2YCX7_BMF-02       -------------KCEE--------------RA-TQTPGPVPASNNG-ML
A0A3P8ZIE7_BMF-01       -------------KYED--------------RG-TQTPTTALALLND-ML
A0A3Q3QZ16_BMF-01       -------------KCED--------------RG-TQTAGPTLAPNNS-ML
A0A3Q3QZ16_BMF-02       -------------KCED--------------RG-TQTAGPTLAPNNS-ML
A0A3Q2PJX9_BMF-02       -------------KCED--------------RG-TQTPGPALAPNNG-ML
A0A3Q2PJX9_BMF-03       -------------KCED--------------RG-TQTPGPALAPNNG-ML
A0A3Q2PJX9_BMF-01       -------------KCED--------------RG-TQTPGPALAPNNG-ML
A0A3B5QK08_BMF-01       -------------KCED--------------RG-TQTPGPGQALHNG-ML
A0A3B5QK08_BMF-02       -------------KCED--------------RG-TQTPGPGQALHNG-ML
A0A096LRV0_BMF-01       -------------KCED--------------RG-TQTPGPGQALHNG-ML
A0A3B3WU80_BMF-01       -------------KCED--------------RG-TQTPGPGQALHNG-ML
A0A3P9Q8E2_BMF-01       -------------KCED--------------RG-TQTPGPGQALHNG-ML
A0A3Q2E3E8_BMF-02       -------------KFED--------------RG-TQTPGPGVAPHNV-ML
A0A3Q2E3E8_BMF-01       -------------KFED--------------RG-TQTPGPGVAPHNV-ML
A0A3Q3GUU5_BMF-01       -------------KCED--------------RG-TQTPGPALAPNNG-ML
A0A3B5B8F6_BMF-01       -------------KCED--------------RG-TQTPGPALQPNNG-ML
A0A3P8UA78_BMF-01       -------------RCED--------------RG-TQTPGPDLALNNG-ML
A0A3P8UA78_BMF-03       -------------RCED--------------RG-TQTPGPDLALNNG-ML
A0A3P8UA78_BMF-02       -------------RCED--------------RG-TQTPGPDLALNNG-ML
A0A3B3CGR9_BMF-01       -------------KCED--------------RG-TQTPGPALVPNNG-ML
A0A3B3I0V9_BMF-04       -------------KCED--------------RG-TQTPGPALVPNNG-ML
A0A3B3I0V9_BMF-02       -------------KCED--------------RG-TQTPGPALVPNNG-ML
A0A3B3I0V9_BMF-01       -------------KCED--------------RG-TQTPGPALVPNNG-ML
A0A3B3I0V9_BMF-03       -------------KCED--------------RG-TQTPGPALVPNNG-ML
A0A3P9JM16_BMF-03       -------------KCED--------------RG-TQTPGPALVPNNG-ML
A0A3P9JM16_BMF-02       -------------KCED--------------RG-TQTPGPALVPNNG-ML
A0A3P9JM16_BMF-01       -------------KCED--------------RG-TQTPGPALVPNNG-ML
A0A3Q2ZA20_BMF-01       -------------KCED--------------RG-TQTPGPALVPHSG-ML
A0A3P8NFE2_BMF-02       -------------KCEH--------------RG-TQTPGPALVPNNG-ML
I3K2D6_BMF-01           -------------KCEH--------------RG-TQTPGPALVPNNG-ML
A0A3P8NFE2_BMF-01       -------------KCEH--------------RG-TQTPGPALVPNNG-ML
A0A3Q3C5V2_BMF-01       -------------KCEH--------------RG-TQTPGPALVPNNG-ML
A0A3P9DPJ5_BMF-02       -------------KCEH--------------RG-TQTPGPALVPNNG-ML
A0A3P9DPJ5_BMF-01       -------------KCEH--------------RG-TQTPGPALVPNNG-ML
A0A3B4ETH0_BMF-01       -------------KCEH--------------RG-TQTPGPALVPNNG-ML
A0A3Q4G1I4_BMF-01       -------------KCEH--------------RG-TQTPGPALVPNNG-ML
A0A3Q1FVH7_BMF-01       -------------KCED--------------RG-TQTPGPALQPNNG-ML
A0A3Q1FVH7_BMF-02       -------------KCED--------------RG-TQTPGPALQPNNG-ML
A0A3Q1D1K3_BMF-01       -------------KCED--------------RG-TQTPGPALQPNNG-ML
A0A3P8RKY9_BMF-01       -------------KCED--------------RG-TQTPGPALQPNNG-ML
A0A3Q1IPR4_BMF-01       -------------KCQD--------------RG-TQTPGPALPQNNG-ML
A0A3B4U5H8_BMF-01       -------------KCED--------------RG-TQTPGPALALNNG-ML
A0A3B4WM88_BMF-01       -------------KCED--------------RG-TQTPGPALALNNG-ML
A0A3Q3LME3_BMF-01       -------------KCED--------------RG-TQTPGPALALNNG-ML
A0A3Q3LME3_BMF-02       -------------KCED--------------RG-TQTPGPALALNNG-ML
A0A3Q3LME3_BMF-03       -------------KCED--------------RG-TQTPGPALALNNG-ML
A0A3Q3VLX6_BMF-01       -------------KCED--------------RG-TQTPGPALAPYSG-ML
A0A3B5KWG6_BMF-01       -------------KCED--------------RG-TQTPGPTLAPHSG-ML
A0A286XF37_PMAIP1-      TEALE----VLAEMAGK--------------KA-RKSSEPDP--------
Q9JM54_PMAIP1-01        PTRVP----ADLKDECA--------------QL-RRIGDKVNLRQKLLNL
Q5U777_PMAIP1-01        PTRVP----ADLKDECD--------------QL-RRIGDKVNLRQKLLNF
F1SMU1_PMAIP1-01        FAEMPGRRSRR--NTQT--------------NP-TRVALPPD--------
A0A3B3QC78_BCL2L11      ISLPN----SP-FMTHN--------------KS-TQTPSPSN--HLVCIY
A0A3Q2U844_BCL2L11      AERSP----AP--MSCD--------------KA-TQTPSPPC--QAVSHY
G3SU55_BCL2L11-01       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAINHY
G3W979_BCL2L11-01       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6KS56_BBC3-02      ---------YRRRRQEE--------------QQ-RHRPSPWR--VLYNLI
A0A3Q3SYA1_BCL2L11      GDSLPSSPLSPRPVTAD--------------KA-TQTPSLTS--QVMNHA
A0A2K5JY52_PMAIP1-      LRNLT----ATKTCMRG--------------LQ-KRIFLRRCTFHQFEAR
A0A096MPU8_PMAIP1-      LRNLT----ASKTCIGG--------------LQ-KRLFLRRCTLHQFEER
A0A2K5ZWH1_PMAIP1-      LRNLT----ASKTCIRG--------------LQ-KRLFLRRCILHKFEER
A0A2K5VPX2_PMAIP1-      LRNLT----ASKTCIRG--------------LQ-KRLFLRRCTLHQFEER
A0A2K6BV75_PMAIP1-      LRNLT----ASKTCIRG--------------LQ-KRLFLRRCTLHQFEER
A0A2K6KJF2_PMAIP1-      LRNLT----ASKTCIRG--------------LQ-TRIFLRRCTFHQFEER
A0A2K6NC45_PMAIP1-      LRNLT----ASKTCIRG--------------LQ-TRIFLRRCTFHQFEER
Q13794_PMAIP1-02        LRNLT----ASKTCMRG--------------LL-QKSFLRRCTFHQFEER
A0A2R9AKC9_PMAIP1-      LRNLT----ASKTCMRG--------------LL-QKSFLRRCTFHQFEER
A0A1D5QGJ8_PMAIP1-      LRNLT----ASKTCIRG--------------LQ-KRLFLRRCTLHQFEER
A0A2I2YVQ5_PMAIP1-      LRNLT----ASKTCMRG--------------LL-QKSFLRRCTFHQFEER
A0A2I3SX38_PMAIP1-      LRNLT----ASKTCMRG--------------LL-QKSFLRRCTFHQFEER
C1C3S9_BAD-01           ----------L---------------------------------RRMSDE
A0A3B4CPH6_BAD-01       ESDSE----AS---------------------------------SSLTAP
F6Z067_BAD-01           RELRR----MS---------------------------------DEFEKS
A0A3Q2LHE3_BIK-01       TGLRG----VF---------------------------------RSFMDG
A0A452QUG1_BIK-01       TGLRG----VL---------------------------------RSLMDG
A0A452V3L2_BIK-01       TGLRG----VL---------------------------------RSLMDG
M3XHJ5_BCL2L11-01       ---SL----VL---------------------------------STSSSG
W5QCU2_BIK-01           VGLRD----VL---------------------------------RSFMVA
O70337_BIK-04           TGVRG----IF---------------------------------RSLIRS
O70337_BIK-01           TGVRG----IF---------------------------------RSLIRS
O70337_BIK-02           TGVRG----IF---------------------------------RSLIRS
Q925D2_BIK-01           TGVRG----IF---------------------------------RSLIGS
G1TZR9_BIK-01           -GFTG----VL---------------------------------GSVGLH
H0W025_BIK-01           MGLWG----VL---------------------------------GRLTLS
A0A2K5CLG5_BIK-01       -DIGD----VL---------------------------------SGIVEV
F7FUT7_BIK-01           -DIGD----VL---------------------------------SGVVDV
A0A2K6TBD7_BIK-01       -DIRD----VL---------------------------------SGVVDV
H2P4N6_BIK-01           EDIRD----VL---------------------------------RSFTDG
G1S1X2_BIK-01           EDIRD----VL---------------------------------RSFMDG
G3QCT2_BIK-01           EDIRD----VL---------------------------------RSFMDG
A0A2R8ZXD2_BIK-01       EDIRD----VL---------------------------------RSFMDG
H2QLU7_BIK-01           EDIRD----VL---------------------------------RSFMDG
Q13323_BIK-01           EDIRD----VL---------------------------------RSFMDG
A0A2K6MCW0_BIK-01       DDIRD----VL---------------------------------TSFMDG
A0A2K6QK74_BIK-01       DDIRD----VL---------------------------------TSFMDG
A0A0D9QZY8_BIK-01       DDIRD----VL---------------------------------RSFIDG
A0A2K5VW94_BIK-01       DDIRD----VL---------------------------------RSFMDG
A0A2K6DBJ4_BIK-01       DDIRD----VL---------------------------------RSFMDG
A0A2K5J4Q7_BIK-01       DDIRD----VL---------------------------------RSFMDG
A0A096NKG5_BIK-01       DDIRD----VL---------------------------------RSFMDG
A0A2K5LDM6_BIK-01       DDIRD----VL---------------------------------RSFMDG
A0A2K5XSA1_BIK-01       DDIRD----VL---------------------------------RSFLDG
F1PUF4_BIK-01           -GLRG----VL---------------------------------RSFLDG
H0XAE7_BIK-01           -DGQG----VL---------------------------------RSVISG
A0A2K6FM79_BIK-01       -VRWG----VL---------------------------------GSLSDG
A0A3P8XIA2_BCL2L11      CDSIP----SSPLLRNN--------------KS-TQTPSPSS--QVITHA
F7G1G0_HRK-01           LQERT----MW--RRRA--------------RS-RRAAAEAA--GSGGGG
P62816_HRK-03           LHRRA----M---RRRA--------------RP--RDPLP--------AL
P62817_HRK-01           LHRRA----M---RRRA--------------RP--RDPLP--------AL
A0A287A5N9_HRK-01       LHQRT----MW--RRSA--------------RS-RRAPAP--------GA
H2NIS8_HRK-01           LHQRT----MW--RRRA--------------RS-RRAPAP--------SA
A0A2K5KZ69_HRK-01       LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
H2Q6Y8_HRK-01           LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
G3UH24_HRK-01           LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
A0A2K5BYA0_HRK-01       LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
U3E722_HRK-01           LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
A0A452DXE5_HRK-01       LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
A0A0D9SC73_HRK-01       LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
A0A3Q2IBL3_HRK-01       LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
A0A337SQ56_HRK-01       LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
G3QTJ6_HRK-01           LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
O00198_HRK-01           LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
A0A1D5R1E4_HRK-01       LHQRT----MW--RRRA--------------RS-RRAPAS--------GA
A0A2K6AYL7_HRK-01       LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
G1QHD8_HRK-01           LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
G1T7W1_HRK-01           LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
H0Y001_HRK-01           LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
A0A096N944_HRK-01       LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
A0A2K6GL98_HRK-01       LHQRT----MW--RRRA--------------RS-RRAPAP--------GA
E2RLD4_HRK-01           LHQRT----MW--RRRA--------------RS-RRAPAP--------RA
F7GVS7_BAD-04           AGPPP----RP--PRAG--------------LS-LPCPKARP--------
Q2PG01_BAD-01           --GLP----RP--KSAG--------------TA-TQMRQSSSWTRVFQSW
A0A2I3H4B2_BAD-01       --GLP----RP--KSAG--------------TA-TQMRQSSSWTRVFQSW
A0A452IFQ4_BAD-01       LQVLP----RP--KSAG--------------TT-SQLHRGNSWKETLQAW
K7GA86_BCL2L11-01       -DRSP----VP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A3Q2GRS5_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
Q4KMV9_BCL2L11-01       -EVSP----GP--VSCD--------------KS-TQTPSPPC--QAFNHL
F7FTC8_BCL2L11-01       -DRSP----PP--VSCD--------------KS-TQTPSPHC--QAFNHY
A0A2K6E226_BCL2L11      ---------------CD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-11       -------------------------------VS-LCHPGWSA--LVRSWL
F7HHA9_BCL2L11-08       -------------------------------VS-LCCPSWSA--LVLSWL
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-03       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3HW02_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6TRZ5_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5HZI7_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5NU92_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5Z8B6_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I2YQ13_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-15       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2R9CA99_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2J8JCT2_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F7HHA9_BCL2L11-07       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5CAB2_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5X2I7_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3M6I1_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-07       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-22       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A452U4S4_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
O54918_BCL2L11-05       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O88498_BCL2L11-02       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A0D9RWE0_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-05       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-25       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F1SU81_BCL2L11-03       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6GE31_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A286XJN2_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5CAB2_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6TRZ5_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6QIL2_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5NU92_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5HZI7_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5X2I7_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6E226_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5Z8B6_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3M6I1_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3M6I1_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6KJP8_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I2YQ13_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-02       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2R9CA99_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2J8JCT2_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
H2P5E2_BCL2L11-01       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A337SW42_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A452SBG5_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
Q2YDF0_BCL2L11-01       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A287DFJ0_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
Q2YDF0_BCL2L11-03       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A452FCS1_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5CAB2_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5Z8B6_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6KJP8_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6QIL2_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F6XMC1_BCL2L11-09       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6TRZ5_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5HZI7_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2R9CA99_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2J8JCT2_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5NU92_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5X2I7_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F7HHA9_BCL2L11-09       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6E226_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3M6I1_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I2YQ13_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-06       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-23       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3HW02_BCL2L11      -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
M3YDI3_BCL2L11-01       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F6XMC1_BCL2L11-02       -DRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F6XMC1_BCL2L11-01       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F7CXT2_BCL2L11-01       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O54918_BCL2L11-01       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O88498_BCL2L11-01       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A337SW42_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A337SW42_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5NU92_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5HZI7_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I2YQ13_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-24       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-08       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5X2I7_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F7HHA9_BCL2L11-03       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6E226_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5Z8B6_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3HW02_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2R9CA99_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2J8JCT2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3M6I1_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6KJP8_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6QIL2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5CAB2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F6XMC1_BCL2L11-06       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6TRZ5_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5CAB2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6TRZ5_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5CAB2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F6XMC1_BCL2L11-04       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6TRZ5_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5NU92_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I2YQ13_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-18       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5X2I7_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F7HHA9_BCL2L11-01       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6E226_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5Z8B6_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3HW02_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2R9CA99_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2J8JCT2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3M6I1_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6KJP8_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6QIL2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5NU92_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5HZI7_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I2YQ13_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-16       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-12       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5X2I7_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F7HHA9_BCL2L11-06       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6E226_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5Z8B6_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3HW02_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2R9CA99_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2J8JCT2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3M6I1_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6KJP8_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6QIL2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5HZI7_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6GE31_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6GE31_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F6XMC1_BCL2L11-08       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6GE31_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6GE31_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A287DFJ0_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A286XJN2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A286XJN2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5CAB2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F6XMC1_BCL2L11-07       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6TRZ5_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F6XMC1_BCL2L11-05       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6TRZ5_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5CAB2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5NU92_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5HZI7_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5X2I7_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F7HHA9_BCL2L11-02       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6E226_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5Z8B6_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3M6I1_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6KJP8_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6QIL2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I2YQ13_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-09       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-21       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2R9CA99_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2J8JCT2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5NU92_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5HZI7_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5X2I7_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F7HHA9_BCL2L11-04       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6E226_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5Z8B6_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3M6I1_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6KJP8_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6QIL2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I2YQ13_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-20       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3HW02_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2R9CA99_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2J8JCT2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5CAB2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5CAB2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F6XMC1_BCL2L11-03       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6TRZ5_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6TRZ5_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6QIL2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6QIL2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5NU92_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5HZI7_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5X2I7_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6E226_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6E226_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K5Z8B6_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3M6I1_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6KJP8_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2K6KJP8_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I2YQ13_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
O43521_BCL2L11-03       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2I3HW02_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2R9CA99_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A2J8JCT2_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A337SW42_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A452FCS1_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
W5PY58_BCL2L11-01       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
Q2YDF0_BCL2L11-02       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F1SU81_BCL2L11-02       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
G1SSY0_BCL2L11-01       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
H0XW23_BCL2L11-01       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
A0A337SW42_BCL2L11      TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
G1LDR8_BCL2L11-01       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
J9NWV6_BCL2L11-01       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
F1SU81_BCL2L11-01       TDRSP----AP--MSCD--------------KS-TQTPSPPC--QAFNHY
                                                                          

A0A287AZR7_PMAIP1-      PAVK----------------------------------------------
G1MV54_BCL2L11-01       PEIW----------------------------------------------
G1PDJ5_BCL2L11-01       PEMW----------------------------------------------
A0A452J430_PMAIP1-      --TQ----------------------------------------------
A0A1D5PAR2_PMAIP1-      AVAE----------------------------------------------
A0A2K6EM90_PMAIP1-      --EE----------------------------------------------
G1P8F9_PMAIP1-01        --IE----------------------------------------------
Q9JM54_PMAIP1-03        --DE----------------------------------------------
A0A3Q2I0H2_PMAIP1-      --AE----------------------------------------------
G3T0P7_PMAIP1-01        DVVE----------------------------------------------
Q1PCT2_PMAIP1-01        --VE----------------------------------------------
G1LIZ7_PMAIP1-01        --VE----------------------------------------------
A0A452STA4_PMAIP1-      --VE----------------------------------------------
A0A2K5NJZ2_PMAIP1-      --VE----------------------------------------------
A0A0D9S003_PMAIP1-      --VE----------------------------------------------
A0A2K5VPX2_PMAIP1-      --VE----------------------------------------------
A0A2K6BV75_PMAIP1-      --VE----------------------------------------------
A0A2K5ZWH1_PMAIP1-      --VE----------------------------------------------
A0A096MPU8_PMAIP1-      --VE----------------------------------------------
A0A2K5JY52_PMAIP1-      --VE----------------------------------------------
A0A2K6KJF2_PMAIP1-      --VE----------------------------------------------
A0A2K6NC45_PMAIP1-      --VE----------------------------------------------
A0A2K6S6C4_PMAIP1-      --VE----------------------------------------------
A0A2I2YVQ5_PMAIP1-      --VE----------------------------------------------
Q13794_PMAIP1-01        --VE----------------------------------------------
A0A2R9AKC9_PMAIP1-      --VE----------------------------------------------
A0A2I3SX38_PMAIP1-      --VE----------------------------------------------
H2NWG2_PMAIP1-01        --VE----------------------------------------------
A0A2K5CFK7_PMAIP1-      --VE----------------------------------------------
F7GW45_PMAIP1-01        --VE----------------------------------------------
A0A337SUX1_PMAIP1-      --VE----------------------------------------------
A0A3Q1NFP6_PMAIP1-      --VE----------------------------------------------
A0A452EST2_PMAIP1-      --VE----------------------------------------------
W5P738_PMAIP1-01        --VE----------------------------------------------
Q9JM54_PMAIP1-02        --DE----------------------------------------------
A0A2I3HX97_PMAIP1-      --VE----------------------------------------------
A0A452TE71_PMAIP1-      --VE----------------------------------------------
A0A0P0HZF9_PMAIP1-      AVVE----------------------------------------------
Q0GKC8_PMAIP1-01        AVVE----------------------------------------------
Q6JTU4_BCL2L11-01       PEIW----------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
K7E5Y2_BBC3-01          LPSL----------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --II----------------------------------------------
A3KND0_BMF-01           YRMF----------------------------------------------
Q6P7C5_BAD-01           --IF----------------------------------------------
A0A287AEF3_BAD-02       --RM----------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2K5F6X4_BBC3-02      AREI----------------------------------------------
A0A337SQV0_BBC3-03      AREI----------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JLM2_BAD-01       AKKY----------------------------------------------
A0A3Q2LHE3_BIK-02       AELP----------------------------------------------
E7FBJ6_BAD-01           AKKY----------------------------------------------
B5XEF1_BAD-01           AKKY----------------------------------------------
H3D8J8_BAD-01           AKKY----------------------------------------------
A0A3B5L9R9_BAD-01       AKKY----------------------------------------------
Q9GL49_PMAIP1-01        LQSQ----------------------------------------------
A0A3B1IH05_BAD-01       AKKY----------------------------------------------
A0A3Q2QC80_BAD-01       AKKY----------------------------------------------
A0A3Q3MLA0_BAD-02       AKKY----------------------------------------------
A0A3Q3MLA0_BAD-03       AKKY----------------------------------------------
I3K7B6_BAD-01           AKKY----------------------------------------------
A0A3P9B2E4_BAD-01       AKKY----------------------------------------------
A0A3Q3C680_BAD-01       AKKY----------------------------------------------
A0A3P8QRJ7_BAD-01       AKKY----------------------------------------------
A0A3Q4GGN3_BAD-01       AKKY----------------------------------------------
A0A3B4GXJ6_BAD-01       AKKY----------------------------------------------
A0A3Q2D5S0_BAD-01       AKKY----------------------------------------------
A0A3B3BQF7_BAD-01       AKKY----------------------------------------------
A0A3Q1K1C7_BAD-02       AKKY----------------------------------------------
A0A3Q1K1C7_BAD-01       AKKY----------------------------------------------
A0A3Q1GWH9_BAD-01       AKKY----------------------------------------------
A0A3Q1CPU7_BAD-01       AKKY----------------------------------------------
A0A3P8TWH6_BAD-01       AKKY----------------------------------------------
A0A2U9BAC9_BAD-01       AMKY----------------------------------------------
A0A3B4VFC5_BAD-01       AKKY----------------------------------------------
A0A3B4W9T1_BAD-01       AKKY----------------------------------------------
A0A3Q0QNQ2_BAD-01       AKKY----------------------------------------------
A0A3P8WIZ8_BAD-02       AKKY----------------------------------------------
A0A3P8WIZ8_BAD-01       AKKY----------------------------------------------
A0A3P9A5G8_BAD-02       AKKY----------------------------------------------
A0A3P9A5G8_BAD-01       AKKY----------------------------------------------
B5X1T1_BAD-01           AKKY----------------------------------------------
H3ANP3_BAD-03           ARKY----------------------------------------------
H3ANP3_BAD-04           ARKY----------------------------------------------
H3ANP3_BAD-02           ARKY----------------------------------------------
H3ANP3_BAD-01           ARKY----------------------------------------------
A0A3B3QX41_BAD-01       AQRY----------------------------------------------
Q4V925_BAD-02           AKKY----------------------------------------------
Q4V925_BAD-03           AKKY----------------------------------------------
A7MCM4_BAD-01           AKKY----------------------------------------------
Q4V925_BAD-04           AKKY----------------------------------------------
Q4V925_BAD-01           AKKY----------------------------------------------
A0A3P8Y761_BAD-01       AKRY----------------------------------------------
A0A3B5K831_BAD-01       AQRY----------------------------------------------
A0A3B5Q2N7_BAD-01       AKKY----------------------------------------------
A0A087X8P8_BAD-01       AKKY----------------------------------------------
A0A3B3UA11_BAD-01       AKKY----------------------------------------------
A0A3B3YFR1_BAD-01       AKKY----------------------------------------------
A0A3P9Q7C3_BAD-01       AKKY----------------------------------------------
A0A3B3HDU2_BAD-01       AKKY----------------------------------------------
A0A3B5BAL2_BAD-01       AKKY----------------------------------------------
A0A3Q3AEL8_BAD-02       AKKY----------------------------------------------
A0A3Q3AEL8_BAD-01       AKKY----------------------------------------------
G3Q8B3_BAD-01           AKKY----------------------------------------------
A0A3Q2Y0E4_BAD-01       AKKY----------------------------------------------
A0A3Q3R5S3_BAD-01       AKKY----------------------------------------------
A0A3Q3RXS8_BAD-02       AKKY----------------------------------------------
A0A3Q3RXS8_BAD-01       AKKY----------------------------------------------
A0A3Q0QNQ2_BAD-02       AKKY----------------------------------------------
A0A3Q3WTY4_BAD-01       AKKY----------------------------------------------
A0A3B1JXK6_BCL2L11      QAHW----------------------------------------------
A0A3B4BVX1_BCL2L11      RPES----------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      ALQR----------------------------------------------
A0A3P8XIA2_BCL2L11      AMRR----------------------------------------------
A0A3Q1ICY2_BCL2L11      ALQR----------------------------------------------
A0A3Q3K6I5_BCL2L11      ALQC----------------------------------------------
A0A3B4V919_BCL2L11      ALQR----------------------------------------------
A0A3B4XZH1_BCL2L11      ALQR----------------------------------------------
A0A3Q3ESW6_BCL2L11      ALQR----------------------------------------------
A0A3Q2SZH6_BCL2L11      ALQR----------------------------------------------
A0A3B3VNE0_BCL2L11      ALQR----------------------------------------------
A0A3B3YII5_BCL2L11      ALQR----------------------------------------------
A0A3B3YII5_BCL2L11      ALQR----------------------------------------------
A0A3P9N073_BCL2L11      ALQR----------------------------------------------
A0A3Q3B113_BCL2L11      ALQR----------------------------------------------
A0A3B5M375_BCL2L11      ALQR----------------------------------------------
A0A3B5QAM1_BCL2L11      ALQR----------------------------------------------
A0A3B5QAM1_BCL2L11      ALQR----------------------------------------------
A0A2I3HWI8_BBC3-03      AREI----------------------------------------------
A0A2K6FQZ3_BBC3-04      AREI----------------------------------------------
Q9BXH1_BBC3-05          AREI----------------------------------------------
A0A2R9BZA9_BBC3-01      AREI----------------------------------------------
A0A2I3RGH5_BBC3-03      AREI----------------------------------------------
A0A2K5P2T8_BBC3-03      AREI----------------------------------------------
A0A2K5V8J3_BBC3-03      AREI----------------------------------------------
F7FFP6_BBC3-03          AREI----------------------------------------------
A0A2K6ASP2_BBC3-03      AREI----------------------------------------------
A0A2I3N2Z9_BBC3-03      AREI----------------------------------------------
A0A2K6QZU4_BBC3-04      AREI----------------------------------------------
A0A2R8MW85_BBC3-03      AREI----------------------------------------------
A0A2K6STD6_BBC3-02      AREI----------------------------------------------
G3T2N1_BBC3-01          AREI----------------------------------------------
M3Y0R3_BBC3-01          AREI----------------------------------------------
Q99ML1_BBC3-02          AREI----------------------------------------------
Q80ZG6_BBC3-01          AREI----------------------------------------------
H0XQ00_BBC3-01          AREI----------------------------------------------
A0A3Q2GWE8_BBC3-01      AREI----------------------------------------------
A0A3Q1LXZ6_BBC3-01      AREI----------------------------------------------
A0A452E3G1_BBC3-01      AREI----------------------------------------------
J9NTK9_BBC3-01          AREI----------------------------------------------
A0A337SQV0_BBC3-02      AREI----------------------------------------------
F1RM01_BBC3-01          AREI----------------------------------------------
A0A2K6FQZ3_BBC3-01      AREI----------------------------------------------
Q9BXH1_BBC3-06          AREI----------------------------------------------
A0A2I3RGH5_BBC3-01      AREI----------------------------------------------
H2NZD3_BBC3-01          AREI----------------------------------------------
A0A2K6QZU4_BBC3-01      AREI----------------------------------------------
A0A0D9S2H2_BBC3-01      AQEI----------------------------------------------
B4DQK3_BBC3-01          AREI----------------------------------------------
A0A3Q3MLA0_BAD-01       AKKY----------------------------------------------
G1SS60_BAD-01           AQRY----------------------------------------------
K7E5Y2_BBC3-02          DREI----------------------------------------------
A0A3B4DUY7_BAD-01       AKKY----------------------------------------------
A0A337SAW2_BAD-01       ALRY----------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z697_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0C1_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2I3MCN5_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-02       --------------------------------------------------
F7GVS7_BAD-02           --------------------------------------------------
A0A2K6E7J3_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-03       --------------------------------------------------
A0A2K5HKW9_BAD-02       --------------------------------------------------
A0A2K6N1A1_BAD-02       --------------------------------------------------
A0A2K6PUM5_BAD-02       --------------------------------------------------
A0A2K5M0C1_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-03       --------------------------------------------------
F7GVS7_BAD-03           --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2I3MCN5_BAD-02       --------------------------------------------------
A0A2K6E7J3_BAD-03       --------------------------------------------------
A0A2I2Z8C7_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z697_BAD-03       --------------------------------------------------
F6SJL0_BAD-02           --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G3VRY4_BAD-02           ARHY----------------------------------------------
G3VRY4_BAD-01           ARHY----------------------------------------------
G1P8C5_BAD-01           AQRY----------------------------------------------
A0A452ER54_BAD-02       AQRY----------------------------------------------
W5P8G9_BAD-01           AQRY----------------------------------------------
G3TP47_BAD-01           AQRY----------------------------------------------
G1MI17_BAD-01           ALRY----------------------------------------------
A0A287AEF3_BAD-01       AQRY----------------------------------------------
M3YNE7_BAD-01           ALRY----------------------------------------------
A0A452RJM6_BAD-01       ALRY----------------------------------------------
A0A384DJL2_BAD-01       ALRY----------------------------------------------
A0A452ER54_BAD-01       AQRY----------------------------------------------
F1MUT9_BAD-01           AQRY----------------------------------------------
Q3SYZ0_BAD-01           AQRY----------------------------------------------
F7DN67_BAD-01           ARRY----------------------------------------------
O35147_BAD-01           AQRY----------------------------------------------
H0WVR2_BAD-01           AQRY----------------------------------------------
H0V608_BAD-01           AQRY----------------------------------------------
A0A2K5E6K7_BAD-01       AQRY----------------------------------------------
A0A2K6TG62_BAD-01       AQRY----------------------------------------------
A0A0D9R491_BAD-01       AQRY----------------------------------------------
A0A2K5M0C1_BAD-01       AQRY----------------------------------------------
A0A2K5VCD8_BAD-01       AQRY----------------------------------------------
F7GVS7_BAD-01           AQRY----------------------------------------------
A0A2K6E7J3_BAD-01       AQRY----------------------------------------------
A0A2K5XJR2_BAD-01       AQRY----------------------------------------------
A0A2I3MCN5_BAD-04       AQRY----------------------------------------------
A0A2K6N1A1_BAD-01       AQRY----------------------------------------------
A0A2K6PUM5_BAD-01       AQRY----------------------------------------------
A0A2K5HKW9_BAD-01       AQRY----------------------------------------------
B4DZQ9_BAD-01           AQRY----------------------------------------------
A0A2K6GWV0_BAD-01       AQRY----------------------------------------------
F6SJL0_BAD-01           AQRY----------------------------------------------
A0A2I3MCN5_BAD-01       AQRY----------------------------------------------
A0A2I2Z8C7_BAD-02       AQRY----------------------------------------------
A0A2I2Z8C7_BAD-01       AQRY----------------------------------------------
Q92934_BAD-01           AQRY----------------------------------------------
Q92934_BAD-02           AQRY----------------------------------------------
A0A2I3TBK7_BAD-02       AQRY----------------------------------------------
A0A2R8Z697_BAD-01       AQRY----------------------------------------------
A0A2J8TYJ3_BAD-01       AQRY----------------------------------------------
F1PK10_BAD-01           ARRY----------------------------------------------
Q45KI9_BAD-01           ARRY----------------------------------------------
I3MBM5_BAD-01           AQRY----------------------------------------------
I3MBM5_BAD-02           AQRY----------------------------------------------
Q61337_BAD-05           AQRY----------------------------------------------
Q61337_BAD-04           AQRY----------------------------------------------
Q61337_BAD-03           AQRY----------------------------------------------
Q61337_BAD-06           AQRY----------------------------------------------
Q61337_BAD-02           AQRY----------------------------------------------
Q61337_BAD-01           AQRY----------------------------------------------
I3LVX0_BIK-01           AQGL-----ASLRENMWFW-------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
O61667_EGL1-01          SIGY----------------------------------------------
Q9BXH1_BBC3-03          PGGFPLAWGSPQPAP-------------------------------RPAP
F6TGJ4_BMF-01           PCGV-----SETPQR-------------------------------LFYG
A0A452H3N6_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
G1PAU1_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
A2AV74_BMF-02           PCGV-----TEEPQR-------------------------------LFYG
A0A286XXB0_BMF-03       PCGV-----TEEPQR-------------------------------LFYG
I3MDS9_BMF-02           PCGV-----TEEPQR-------------------------------LFYG
A0A287AIU8_BMF-05       PCGV-----TEEPQR-------------------------------LFYG
A0A287AIU8_BMF-04       PCGV-----TEEPQR-------------------------------LFYG
A0A287AIU8_BMF-03       PCGV-----TEEPQR-------------------------------LFYG
A0A287AIU8_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
A0A287AIU8_BMF-02       PCGV-----TEEPQR-------------------------------LFYG
A0A2K5KGR6_BMF-01       PCGV-----TEEPQR-------------------------------LFYA
A0A2K6FFR1_BMF-02       PCGV-----TEEPQR-------------------------------LFYA
M3WRS0_BMF-02           PCGV-----TEEPQR-------------------------------LFYA
A0A2K5E1W9_BMF-02       PCGV-----TEEPQR-------------------------------LFYA
F7HPK0_BMF-02           PCGV-----TEEPQR-------------------------------LFYA
A0A2K6TW86_BMF-03       PCGV-----TEEPQR-------------------------------LFYA
A0A2K6RAW8_BMF-02       PCGV-----TEEPQR-------------------------------LFYA
G3QIN5_BMF-02           PCGV-----TEEPQR-------------------------------LFYA
Q96LC9_BMF-07           PCGV-----TEEPQR-------------------------------LFYA
Q96LC9_BMF-05           PCGV-----TEEPQR-------------------------------LFYA
A0A2R9BS98_BMF-02       PCGV-----TEEPQR-------------------------------LFYA
A0A2J8QDD5_BMF-01       PCGV-----TEEPQR-------------------------------LFYA
A0A2K5MJY6_BMF-01       PCGV-----TEEPQR-------------------------------LFYA
G7PAW6_BMF-01           PCGV-----TEEPQR-------------------------------LFYA
A0A2K6B5G4_BMF-03       PCGV-----TEEPQR-------------------------------LFYA
A0A2K5Z4C3_BMF-02       PCGV-----TEEPQR-------------------------------LFYA
A0A096NTE9_BMF-03       PCGV-----TEEPQR-------------------------------LFYA
A0A2I3HD83_BMF-01       PCGV-----TEEPQR-------------------------------LFYA
A2AV74_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
Q8K589_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
I3MDS9_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
G3T7Z4_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
F6X3N6_BMF-01           PCGV-----TEEPHR-------------------------------LFYG
G3WDQ2_BMF-01           PCGV-----TEEPHR-------------------------------LFYG
Q96LC9_BMF-06           PCGV-----TEEPQR-------------------------------LFYG
F6TJI0_BMF-02           PCGV-----TEEPQR-------------------------------LFYG
F6TJI0_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
A0A286XXB0_BMF-02       PCGV-----TEEPQR-------------------------------LFYG
J9PB65_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
A0A286XXB0_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
G1SR62_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
W5QFV1_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
Q05KI3_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
Q05KI3_BMF-02           PCGV-----TEEPQR-------------------------------LFYG
A0A452F2E0_BMF-02       PCGV-----TEEPQR-------------------------------LFYG
A0A452F2E0_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
M3WRS0_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
A0A2U4BC98_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
M3YAD5_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
A0A452SED0_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
A0A384D070_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
A0A2K6FFR1_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
H0WYH6_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
A0A096NTE9_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
A0A2K6L933_BMF-02       PCGV-----TEEPQR-------------------------------LFYG
A0A096NTE9_BMF-02       PCGV-----TEEPQR-------------------------------LFYG
A0A2K5MJY6_BMF-02       PCGV-----TEEPQR-------------------------------LFYG
A0A2K5KGR6_BMF-02       PCGV-----TEEPQR-------------------------------LFYG
G7PAW6_BMF-02           PCGV-----TEEPQR-------------------------------LFYG
F7CM09_BMF-02           PCGV-----TEEPQR-------------------------------LFYG
A0A2K6B5G4_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
A0A2K6B5G4_BMF-02       PCGV-----TEEPQR-------------------------------LFYG
A0A2K6B5G4_BMF-04       PCGV-----TEEPQR-------------------------------LFYG
A0A2K5Z4C3_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
A0A2K6L933_BMF-03       PCGV-----TEEPQR-------------------------------LFYG
A0A2K6L933_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
A0A2K6RAW8_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
A0A0D9R4R5_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
F7HPK0_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
A0A2K5E1W9_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
A0A2K6TW86_BMF-02       PCGV-----TEEPQR-------------------------------LFYG
A0A2K6TW86_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
G3QIN5_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
Q96LC9_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
Q96LC9_BMF-04           PCGV-----TEEPQR-------------------------------LFYG
Q96LC9_BMF-03           PCGV-----TEEPQR-------------------------------LFYG
Q96LC9_BMF-02           PCGV-----TEEPQR-------------------------------LFYG
A0A2R9BS98_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
A0A2J8QDD5_BMF-02       PCGV-----TEEPQR-------------------------------LFYG
A0A2J8T301_BMF-01       PCGV-----TEEPQR-------------------------------LFYG
H9GL49_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
K7FRX2_BMF-01           PCGV-----TEEPQR-------------------------------LFYG
A9XRG9_BMF-01           PCGV-----TEEPRR-------------------------------LFYG
A9XRG9_BMF-02           PCGV-----TEEPRR-------------------------------LFYG
U3JS06_BMF-01           PCGV-----TEEPRR-------------------------------LFYG
H0ZMX5_BMF-01           PCGV-----TEEPRR-------------------------------LFYG
A9XRG9_BMF-03           PCGV-----TEEPRR-------------------------------LFYG
A9XRG9_BMF-04           PCGV-----TEEPRR-------------------------------LFYG
G1NHG8_BMF-01           PCGV-----TEEPRR-------------------------------LFYG
A0A3B4UNJ0_BMF-01       LTAV-----TAAPLI-------------------------------LFVW
B2KKY9_BCL2L11-01       PAGH-----FDFPQPGEGDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSV
B8JK68_BCL2L11-01       PAGH-----FDFPQPGEGDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSV
A0A3B4B6Y3_BMF-01       PCGV-----AEEPRP-------------------------------LFY-
Q0GKC7_BMF-01           LCRH-----LQQHGH-------------------------------FLYG
A0A3B3RH63_BMF-01       PCGV-----GQEPRR-------------------------------LFYG
W5N4P7_BMF-01           PCGV-----GAEPRR-------------------------------LFYG
A0A3B1K1X5_BMF-01       PCGI-----SEEPRR-------------------------------LFYG
A0A3B4CNJ8_BMF-01       PCGV-----SEEPRR-------------------------------LFYG
A0A2U9CJH3_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3Q2YCX7_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3Q2YCX7_BMF-02       PCGV-----AEEPRP-------------------------------LFYG
A0A3P8ZIE7_BMF-01       PCRL-----DQDPRP-------------------------------LFYG
A0A3Q3QZ16_BMF-01       PCGV-----AEDPRP-------------------------------LFYG
A0A3Q3QZ16_BMF-02       PCGV-----AEDPRP-------------------------------LFYG
A0A3Q2PJX9_BMF-02       PCGV-----AEEPRQ-------------------------------LFYG
A0A3Q2PJX9_BMF-03       PCGV-----AEEPRQ-------------------------------LFYG
A0A3Q2PJX9_BMF-01       PCGV-----AEEPRQ-------------------------------LFYG
A0A3B5QK08_BMF-01       PCGV-----VEEPRR-------------------------------LFYG
A0A3B5QK08_BMF-02       PCGV-----VEEPRR-------------------------------LFYG
A0A096LRV0_BMF-01       PCGV-----AEEPRR-------------------------------LFYG
A0A3B3WU80_BMF-01       PCGV-----AEEPRR-------------------------------LFYG
A0A3P9Q8E2_BMF-01       PCGV-----AEEPRR-------------------------------LFYG
A0A3Q2E3E8_BMF-02       PCGV-----VEEPRP-------------------------------LFYR
A0A3Q2E3E8_BMF-01       PCGV-----VEEPRP-------------------------------LFYR
A0A3Q3GUU5_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3B5B8F6_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3P8UA78_BMF-01       PCGV-----GEEPRP-------------------------------LFYG
A0A3P8UA78_BMF-03       PCGV-----GEEPRP-------------------------------LFYG
A0A3P8UA78_BMF-02       PCGV-----GEEPRP-------------------------------LFYG
A0A3B3CGR9_BMF-01       LCGL-----AEEPRP-------------------------------LFYG
A0A3B3I0V9_BMF-04       LCGL-----AEEPRP-------------------------------LFYG
A0A3B3I0V9_BMF-02       LCGL-----AEEPRP-------------------------------LFYG
A0A3B3I0V9_BMF-01       LCGL-----AEEPRP-------------------------------LFYG
A0A3B3I0V9_BMF-03       LCGL-----AEEPRP-------------------------------LFYG
A0A3P9JM16_BMF-03       LCGL-----AEEPRP-------------------------------LFYG
A0A3P9JM16_BMF-02       LCGL-----AEEPRP-------------------------------LFYG
A0A3P9JM16_BMF-01       LCGL-----AEEPRP-------------------------------LFYG
A0A3Q2ZA20_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3P8NFE2_BMF-02       PCGV-----AEEPRP-------------------------------LFYG
I3K2D6_BMF-01           PCGV-----AEEPRP-------------------------------LFYG
A0A3P8NFE2_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3Q3C5V2_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3P9DPJ5_BMF-02       PCGV-----AEEPRP-------------------------------LFYG
A0A3P9DPJ5_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3B4ETH0_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3Q4G1I4_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3Q1FVH7_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3Q1FVH7_BMF-02       PCGV-----AEEPRP-------------------------------LFYG
A0A3Q1D1K3_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3P8RKY9_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3Q1IPR4_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3B4U5H8_BMF-01       PCGV-----AKEPRP-------------------------------LFYG
A0A3B4WM88_BMF-01       PCGV-----AKEPRP-------------------------------LFYG
A0A3Q3LME3_BMF-01       PCGV-----AEEPRP-------------------------------LFYG
A0A3Q3LME3_BMF-02       PCGV-----AEEPRP-------------------------------LFYG
A0A3Q3LME3_BMF-03       PCGV-----AEEPRP-------------------------------LFYG
A0A3Q3VLX6_BMF-01       PCGV-----AEEPRH-------------------------------LFYV
A0A3B5KWG6_BMF-01       PCGV-----AEEPRL-------------------------------LFYG
A0A286XF37_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        ISKLFNLVT-----------------------------------------
Q5U777_PMAIP1-01        ISKLFNLIT-----------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A3B3QC78_BCL2L11      LSSV--------TRT-----------------------------------
A0A3Q2U844_BCL2L11      LSAM-----ASRWRS-----------------------------------
G3SU55_BCL2L11-01       LSAM-----ASMRQS-----------------------------------
G3W979_BCL2L11-01       LSAMDT---ASMRQS-----------------------------------
A0A2K6KS56_BBC3-02      MGLL-----PLPRGH-----------------------------------
A0A3Q3SYA1_BCL2L11      LQRL-----AEAHGG-----------------------------------
A0A2K5JY52_PMAIP1-      LHCN----------------------------------------------
A0A096MPU8_PMAIP1-      LHCNW---------------------------------------------
A0A2K5ZWH1_PMAIP1-      LHCNW---------------------------------------------
A0A2K5VPX2_PMAIP1-      LHCNW---------------------------------------------
A0A2K6BV75_PMAIP1-      LHCNW---------------------------------------------
A0A2K6KJF2_PMAIP1-      LHCNW---------------------------------------------
A0A2K6NC45_PMAIP1-      LHCNW---------------------------------------------
Q13794_PMAIP1-02        LHCN----------------------------------------------
A0A2R9AKC9_PMAIP1-      LHCNW---------------------------------------------
A0A1D5QGJ8_PMAIP1-      LHCN----------------------------------------------
A0A2I2YVQ5_PMAIP1-      LHCNWEECEGAFMGA-----------------------------------
A0A2I3SX38_PMAIP1-      LHCNW---------------------------------------------
C1C3S9_BAD-01           FDQIFTSI------------------------------------------
A0A3B4CPH6_BAD-01       DTRPAE--------------------------------------------
F6Z067_BAD-01           FTGL----------------------------------------------
A0A3Q2LHE3_BIK-01       LTNLRENI-RFWSF------------------------------------
A0A452QUG1_BIK-01       LTNLRENI-RIWSF------------------------------------
A0A452V3L2_BIK-01       LTNLRENI-RIWSF------------------------------------
M3XHJ5_BCL2L11-01       YFTFDSDIVHS---------------------------------------
W5QCU2_BIK-01           FTNLRENR-RLWSF------------------------------------
O70337_BIK-04           LTNLRENIWS-WRV------------------------------------
O70337_BIK-01           LTNLRENIWS-WRV------------------------------------
O70337_BIK-02           LTNLRENIWS-WRV------------------------------------
Q925D2_BIK-01           LTNLRENIWS-WRV------------------------------------
G1TZR9_BIK-01           LASLVE----LWSPW-----------------------------------
H0W025_BIK-01           LASLRDNV---WACG-----------------------------------
A0A2K5CLG5_BIK-01       FANFQEDIVRLWRS------------------------------------
F7FUT7_BIK-01           FANFQEDIVRLWRS------------------------------------
A0A2K6TBD7_BIK-01       FADFQEDIVRLWRS------------------------------------
H2P4N6_BIK-01           FTTLKENIMRFWSS------------------------------------
G1S1X2_BIK-01           FTTFKENIIRLWRS------------------------------------
G3QCT2_BIK-01           FTTLKENIMRFWRS------------------------------------
A0A2R8ZXD2_BIK-01       FTTLKENIMRFWRS------------------------------------
H2QLU7_BIK-01           FTTLKENIMRFWRS------------------------------------
Q13323_BIK-01           FTTLKENIMRFWRS------------------------------------
A0A2K6MCW0_BIK-01       FTTLKENIMRFWRS------------------------------------
A0A2K6QK74_BIK-01       FTTLKENIMRFWRS------------------------------------
A0A0D9QZY8_BIK-01       FTTLRENIMRFWRS------------------------------------
A0A2K5VW94_BIK-01       FTTLRENIMRFWRS------------------------------------
A0A2K6DBJ4_BIK-01       FTTLRENIMRFWRS------------------------------------
A0A2K5J4Q7_BIK-01       FTTLKENIMRFWRS------------------------------------
A0A096NKG5_BIK-01       FTTLRENIMRFWRS------------------------------------
A0A2K5LDM6_BIK-01       FTTLRENIMRFWRS------------------------------------
A0A2K5XSA1_BIK-01       FTTLRENIMRFWRS------------------------------------
F1PUF4_BIK-01           LANLRENI-RIWSF------------------------------------
H0XAE7_BIK-01           FTNLRENIAGFWRS------------------------------------
A0A2K6FM79_BIK-01       FANLREYVARLWRS------------------------------------
A0A3P8XIA2_BCL2L11      MR------------------------------------------------
F7G1G0_HRK-01           LPAY----------------------------------------------
P62816_HRK-03           LPAL----------------------------------------------
P62817_HRK-01           LPAL----------------------------------------------
A0A287A5N9_HRK-01       LPTY----------------------------------------------
H2NIS8_HRK-01           LPTY----------------------------------------------
A0A2K5KZ69_HRK-01       LPTY----------------------------------------------
H2Q6Y8_HRK-01           LPTY----------------------------------------------
G3UH24_HRK-01           LPTY----------------------------------------------
A0A2K5BYA0_HRK-01       LPTY----------------------------------------------
U3E722_HRK-01           LPTY----------------------------------------------
A0A452DXE5_HRK-01       LPTY----------------------------------------------
A0A0D9SC73_HRK-01       LPTY----------------------------------------------
A0A3Q2IBL3_HRK-01       LPTY----------------------------------------------
A0A337SQ56_HRK-01       LPTY----------------------------------------------
G3QTJ6_HRK-01           LPTY----------------------------------------------
O00198_HRK-01           LPTY----------------------------------------------
A0A1D5R1E4_HRK-01       LPTY----------------------------------------------
A0A2K6AYL7_HRK-01       LPTY----------------------------------------------
G1QHD8_HRK-01           LPTY----------------------------------------------
G1T7W1_HRK-01           LPTY----------------------------------------------
H0Y001_HRK-01           LTTY----------------------------------------------
A0A096N944_HRK-01       LPTY----------------------------------------------
A0A2K6GL98_HRK-01       LTTY----------------------------------------------
E2RLD4_HRK-01           LPTY----------------------------------------------
F7GVS7_BAD-04           ----------DLMSH-----------------------------------
Q2PG01_BAD-01           WD-------RNLGRG-----------------------------------
A0A2I3H4B2_BAD-01       WD-------RNLGRG-----------------------------------
A0A452IFQ4_BAD-01       L--------GHRPAR-----------------------------------
K7GA86_BCL2L11-01       LSAMGKQDHASRWES-----------------------------------
A0A3Q2GRS5_BCL2L11      LSAM-----ASMRQS-----------------------------------
Q4KMV9_BCL2L11-01       LSAM-----ADRN-------------------------------------
F7FTC8_BCL2L11-01       LSAM-----ASIRQP-----------------------------------
A0A2K6E226_BCL2L11      LSAM-----ASRR-------------------------------------
O43521_BCL2L11-11       TATS-----NSQVQA-----------------------------------
F7HHA9_BCL2L11-08       TATS-----NSQVQA-----------------------------------
O54918_BCL2L11-06       ---------ASIRQS-----------------------------------
O54918_BCL2L11-08       ---------ASIRQS-----------------------------------
O54918_BCL2L11-03       LSAM-----DQLENL-----------------------------------
A0A2I3HW02_BCL2L11      LSAM-----DEAAGS-----------------------------------
A0A2K6TRZ5_BCL2L11      LSAM-----DEATGS-----------------------------------
A0A2K5HZI7_BCL2L11      LSAM-----DEATGS-----------------------------------
A0A2K5NU92_BCL2L11      LSAM-----DEATGS-----------------------------------
A0A2K5Z8B6_BCL2L11      LSAM-----DEATGS-----------------------------------
A0A2I2YQ13_BCL2L11      LSAM-----DDSAGS-----------------------------------
O43521_BCL2L11-15       LSAM-----DDSAGS-----------------------------------
A0A2R9CA99_BCL2L11      LSAM-----DDSAGS-----------------------------------
A0A2J8JCT2_BCL2L11      LSAM-----DDSAGS-----------------------------------
F7HHA9_BCL2L11-07       LSAM-----DEATGS-----------------------------------
A0A2K5CAB2_BCL2L11      LSAM-----DEATES-----------------------------------
A0A2K5X2I7_BCL2L11      LSAM-----DEATGS-----------------------------------
A0A2I3M6I1_BCL2L11      LSAM-----DEATGS-----------------------------------
O43521_BCL2L11-07       LSAM---------VR-----------------------------------
O43521_BCL2L11-22       LSAM---------VR-----------------------------------
A0A452U4S4_BCL2L11      LSAM-----DLWTVE-----------------------------------
C1KGB8_BCL2L11-01       ---------ASMRQS-----------------------------------
A0A2K6GE31_BCL2L11      ---------ASMRQF-----------------------------------
A0A337SW42_BCL2L11      ---------ASMRQP-----------------------------------
O43521_BCL2L11-17       ---------ASMRQA-----------------------------------
O43521_BCL2L11-10       ---------ASMRQA-----------------------------------
A0A2I2YQ13_BCL2L11      ---------ASMRQA-----------------------------------
O43521_BCL2L11-19       ---------ASMRQA-----------------------------------
O43521_BCL2L11-13       ---------ASMRQA-----------------------------------
A0A2I3HW02_BCL2L11      ---------ASMRQA-----------------------------------
A0A2R9CA99_BCL2L11      ---------ASMRQA-----------------------------------
A0A2J8JCT2_BCL2L11      ---------ASMRQA-----------------------------------
A0A2K5NU92_BCL2L11      ---------ASRRQA-----------------------------------
A0A2K5X2I7_BCL2L11      ---------ASRRQA-----------------------------------
F7HHA9_BCL2L11-05       ---------ASRRQA-----------------------------------
A0A2K5Z8B6_BCL2L11      ---------ASRRQA-----------------------------------
A0A2K5HZI7_BCL2L11      ---------ASRRQA-----------------------------------
A0A2K6KJP8_BCL2L11      ---------ASRRQA-----------------------------------
A0A2K6QIL2_BCL2L11      ---------ASRRQA-----------------------------------
O54918_BCL2L11-05       LSAM-----ASIRQS-----------------------------------
O88498_BCL2L11-02       LSAM-----ASIRQS-----------------------------------
A0A0D9RWE0_BCL2L11      LSAM-----ASRR-------------------------------------
O43521_BCL2L11-05       LSAM-----ASMR-------------------------------------
O43521_BCL2L11-25       LSAM-----ASMR-------------------------------------
F1SU81_BCL2L11-03       LSAM-----ASMRQS-----------------------------------
A0A2K6GE31_BCL2L11      LSAM-----ASMRQF-----------------------------------
A0A286XJN2_BCL2L11      LSAM-----ASMRQS-----------------------------------
A0A2K5CAB2_BCL2L11      LSAM-----ASMRQS-----------------------------------
A0A2K6TRZ5_BCL2L11      LSAM-----ASMRQS-----------------------------------
A0A2K6QIL2_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5NU92_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5HZI7_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5X2I7_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K6E226_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5Z8B6_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2I3M6I1_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2I3M6I1_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K6KJP8_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2I2YQ13_BCL2L11      LSAM-----ASMR-------------------------------------
O43521_BCL2L11-02       LSAM-----ASMR-------------------------------------
A0A2R9CA99_BCL2L11      LSAM-----ASMR-------------------------------------
A0A2J8JCT2_BCL2L11      LSAM-----ASMR-------------------------------------
H2P5E2_BCL2L11-01       LSAM-----ASMR-------------------------------------
A0A337SW42_BCL2L11      LSAM-----ASMRQP-----------------------------------
A0A452SBG5_BCL2L11      LSAM-----ASMRQS-----------------------------------
Q2YDF0_BCL2L11-01       LSAM-----ASMRQS-----------------------------------
A0A287DFJ0_BCL2L11      LSAM-----ASMRES-----------------------------------
Q2YDF0_BCL2L11-03       LSAM-----ASMRQS-----------------------------------
A0A452FCS1_BCL2L11      LSAM-----ASMRQS-----------------------------------
A0A2K5CAB2_BCL2L11      LSAM----------------------------------------------
A0A2K5Z8B6_BCL2L11      LSAM-----VVILED-----------------------------------
A0A2K6KJP8_BCL2L11      LSAM-----VVILED-----------------------------------
A0A2K6QIL2_BCL2L11      LSAM-----VVILED-----------------------------------
F6XMC1_BCL2L11-09       LSAM-----VVIRMD-----------------------------------
A0A2K6TRZ5_BCL2L11      LSAM-----VVIRMD-----------------------------------
A0A2K5HZI7_BCL2L11      LSAM-----VVILED-----------------------------------
A0A2R9CA99_BCL2L11      LSAM-----VVILED-----------------------------------
A0A2J8JCT2_BCL2L11      LSAM-----VVILED-----------------------------------
A0A2K5NU92_BCL2L11      LSAM-----VVILED-----------------------------------
A0A2K5X2I7_BCL2L11      LSAM-----VVILED-----------------------------------
F7HHA9_BCL2L11-09       LSAM-----VVILED-----------------------------------
A0A2K6E226_BCL2L11      LSAM-----VVILED-----------------------------------
A0A2I3M6I1_BCL2L11      LSAM-----VVILED-----------------------------------
A0A2I2YQ13_BCL2L11      LSAM-----VVILED-----------------------------------
O43521_BCL2L11-06       LSAM-----VVILED-----------------------------------
O43521_BCL2L11-23       LSAM-----VVILED-----------------------------------
A0A2I3HW02_BCL2L11      LSAM-----VVILED-----------------------------------
M3YDI3_BCL2L11-01       LSAM-----ASRRQS-----------------------------------
F6XMC1_BCL2L11-02       LSAM-----ASMRQS-----------------------------------
F6XMC1_BCL2L11-01       LSAM-----ASMRQS-----------------------------------
F7CXT2_BCL2L11-01       LSAM-----ASMRQS-----------------------------------
O54918_BCL2L11-01       LSAM-----ASIRQS-----------------------------------
O88498_BCL2L11-01       LSAM-----ASIRQS-----------------------------------
A0A337SW42_BCL2L11      LSAM----------------------------------------------
A0A337SW42_BCL2L11      LSAM-----VRAI-------------------------------------
A0A2K5NU92_BCL2L11      LSAM-----VREI-------------------------------------
A0A2K5HZI7_BCL2L11      LSAM-----VREI-------------------------------------
A0A2I2YQ13_BCL2L11      LSAM-----VREI-------------------------------------
O43521_BCL2L11-24       LSAM-----VREI-------------------------------------
O43521_BCL2L11-08       LSAM-----VREI-------------------------------------
A0A2K5X2I7_BCL2L11      LSAM-----VREI-------------------------------------
F7HHA9_BCL2L11-03       LSAM-----VREI-------------------------------------
A0A2K6E226_BCL2L11      LSAM-----VREI-------------------------------------
A0A2K5Z8B6_BCL2L11      LSAM-----VREI-------------------------------------
A0A2I3HW02_BCL2L11      LSAM-----VREI-------------------------------------
A0A2R9CA99_BCL2L11      LSAM-----VREI-------------------------------------
A0A2J8JCT2_BCL2L11      LSAM-----VREI-------------------------------------
A0A2I3M6I1_BCL2L11      LSAM-----VREI-------------------------------------
A0A2K6KJP8_BCL2L11      LSAM-----VREI-------------------------------------
A0A2K6QIL2_BCL2L11      LSAM-----VREI-------------------------------------
A0A2K5CAB2_BCL2L11      LSAM-----VREI-------------------------------------
F6XMC1_BCL2L11-06       LSAM-----VREI-------------------------------------
A0A2K6TRZ5_BCL2L11      LSAM-----VREI-------------------------------------
A0A2K5CAB2_BCL2L11      LSAM-----ADWD-------------------------------------
A0A2K6TRZ5_BCL2L11      LSAM-----ADWD-------------------------------------
A0A2K5CAB2_BCL2L11      LSAM-----GIFE-------------------------------------
F6XMC1_BCL2L11-04       LSAM-----GIFE-------------------------------------
A0A2K6TRZ5_BCL2L11      LSAM-----GIFE-------------------------------------
A0A2K5NU92_BCL2L11      LSAM-----GIFE-------------------------------------
A0A2I2YQ13_BCL2L11      LSAM-----GIFE-------------------------------------
O43521_BCL2L11-18       LSAM-----GIFE-------------------------------------
A0A2K5X2I7_BCL2L11      LSAM-----GIFE-------------------------------------
F7HHA9_BCL2L11-01       LSAM-----GIFE-------------------------------------
A0A2K6E226_BCL2L11      LSAM-----GIFE-------------------------------------
A0A2K5Z8B6_BCL2L11      LSAM-----GIFE-------------------------------------
A0A2I3HW02_BCL2L11      LSAM-----GIFE-------------------------------------
A0A2R9CA99_BCL2L11      LSAM-----GIFE-------------------------------------
A0A2J8JCT2_BCL2L11      LSAM-----GIFE-------------------------------------
A0A2I3M6I1_BCL2L11      LSAM-----GIFE-------------------------------------
A0A2K6KJP8_BCL2L11      LSAM-----GIFE-------------------------------------
A0A2K6QIL2_BCL2L11      LSAM-----GIFE-------------------------------------
A0A2K5NU92_BCL2L11      LSAM-----ANWD-------------------------------------
A0A2K5HZI7_BCL2L11      LSAM-----ANWD-------------------------------------
A0A2I2YQ13_BCL2L11      LSAM-----ANWD-------------------------------------
O43521_BCL2L11-16       LSAM-----ANWD-------------------------------------
O43521_BCL2L11-12       LSAM-----ANWD-------------------------------------
A0A2K5X2I7_BCL2L11      LSAM-----ANWD-------------------------------------
F7HHA9_BCL2L11-06       LSAM-----ANWD-------------------------------------
A0A2K6E226_BCL2L11      LSAM-----ANWD-------------------------------------
A0A2K5Z8B6_BCL2L11      LSAM-----ANWD-------------------------------------
A0A2I3HW02_BCL2L11      LSAM-----ANWD-------------------------------------
A0A2R9CA99_BCL2L11      LSAM-----ANWD-------------------------------------
A0A2J8JCT2_BCL2L11      LSAM-----ANWD-------------------------------------
A0A2I3M6I1_BCL2L11      LSAM-----ANWD-------------------------------------
A0A2K6KJP8_BCL2L11      LSAM-----ANWD-------------------------------------
A0A2K6QIL2_BCL2L11      LSAM-----ANWD-------------------------------------
A0A2K5HZI7_BCL2L11      LSAM-----GVFE-------------------------------------
A0A2K6GE31_BCL2L11      LSAM-----VREI-------------------------------------
A0A2K6GE31_BCL2L11      LSAM----------------------------------------------
F6XMC1_BCL2L11-08       LSAM-----GYRLTG-----------------------------------
A0A2K6GE31_BCL2L11      LSAM-----ASMRQF-----------------------------------
A0A2K6GE31_BCL2L11      LSAM-----ASMRQF-----------------------------------
A0A287DFJ0_BCL2L11      LSAM-----ASMRES-----------------------------------
A0A286XJN2_BCL2L11      LSAM-----ASMRQS-----------------------------------
A0A286XJN2_BCL2L11      LSAM-----ASMRQS-----------------------------------
A0A2K5CAB2_BCL2L11      LSAM-----ASMRQS-----------------------------------
F6XMC1_BCL2L11-07       LSAM-----ASMRQS-----------------------------------
A0A2K6TRZ5_BCL2L11      LSAM-----ASMRQS-----------------------------------
F6XMC1_BCL2L11-05       LSAM-----ASMRQS-----------------------------------
A0A2K6TRZ5_BCL2L11      LSAM-----ASMRQS-----------------------------------
A0A2K5CAB2_BCL2L11      LSAM-----ASMRQS-----------------------------------
A0A2K5NU92_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5HZI7_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5X2I7_BCL2L11      LSAM-----ASRR-------------------------------------
F7HHA9_BCL2L11-02       LSAM-----ASRR-------------------------------------
A0A2K6E226_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5Z8B6_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2I3M6I1_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K6KJP8_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K6QIL2_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2I2YQ13_BCL2L11      LSAM-----ASMR-------------------------------------
O43521_BCL2L11-09       LSAM-----ASMR-------------------------------------
O43521_BCL2L11-21       LSAM-----ASMR-------------------------------------
A0A2R9CA99_BCL2L11      LSAM-----ASMR-------------------------------------
A0A2J8JCT2_BCL2L11      LSAM-----ASMR-------------------------------------
A0A2K5NU92_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5HZI7_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5X2I7_BCL2L11      LSAM-----ASRR-------------------------------------
F7HHA9_BCL2L11-04       LSAM-----ASRR-------------------------------------
A0A2K6E226_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5Z8B6_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2I3M6I1_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K6KJP8_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K6QIL2_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2I2YQ13_BCL2L11      LSAM-----ASMR-------------------------------------
O43521_BCL2L11-20       LSAM-----ASMR-------------------------------------
A0A2I3HW02_BCL2L11      LSAM-----ASMR-------------------------------------
A0A2R9CA99_BCL2L11      LSAM-----ASMR-------------------------------------
A0A2J8JCT2_BCL2L11      LSAM-----ASMR-------------------------------------
A0A2K5CAB2_BCL2L11      LSAM-----ASMRQS-----------------------------------
A0A2K5CAB2_BCL2L11      LSAM-----ASMRQS-----------------------------------
F6XMC1_BCL2L11-03       LSAM-----ASMRQS-----------------------------------
A0A2K6TRZ5_BCL2L11      LSAM-----ASMRQS-----------------------------------
A0A2K6TRZ5_BCL2L11      LSAM-----ASMRQS-----------------------------------
A0A2K6QIL2_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K6QIL2_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5NU92_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5HZI7_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5X2I7_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K6E226_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K6E226_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K5Z8B6_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2I3M6I1_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K6KJP8_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2K6KJP8_BCL2L11      LSAM-----ASRR-------------------------------------
A0A2I2YQ13_BCL2L11      LSAM-----ASMR-------------------------------------
O43521_BCL2L11-03       LSAM-----ASMR-------------------------------------
A0A2I3HW02_BCL2L11      LSAM-----ASMR-------------------------------------
A0A2R9CA99_BCL2L11      LSAM-----ASMR-------------------------------------
A0A2J8JCT2_BCL2L11      LSAM-----ASMR-------------------------------------
A0A337SW42_BCL2L11      LSAM-----ASMRQP-----------------------------------
A0A452FCS1_BCL2L11      LSAM-----ASMRQS-----------------------------------
W5PY58_BCL2L11-01       LSAM-----ASMRQS-----------------------------------
Q2YDF0_BCL2L11-02       LSAM-----ASMRQS-----------------------------------
F1SU81_BCL2L11-02       LSAM-----ASMRQS-----------------------------------
G1SSY0_BCL2L11-01       LSAM-----ASMRQS-----------------------------------
H0XW23_BCL2L11-01       LSAM-----ASMRQS-----------------------------------
A0A337SW42_BCL2L11      LSAM-----ASMRQP-----------------------------------
G1LDR8_BCL2L11-01       LSAM-----ASMRQS-----------------------------------
J9NWV6_BCL2L11-01       LSAM-----ASMRQS-----------------------------------
F1SU81_BCL2L11-01       LSAM-----ASMRQS-----------------------------------
                                                                          

A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
K7E5Y2_BBC3-01          ------------------------GPRSAQEEGGQEGEPQGASPMSGGPP
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       -------------------------------------------------I
A3KND0_BMF-01           -------------------------------------------------N
Q6P7C5_BAD-01           -------------------------------------------------L
A0A287AEF3_BAD-02       -------------------------------------------------R
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JLM2_BAD-01       --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
A0A3Q2QC80_BAD-01       --------------------------------------------------
A0A3Q3MLA0_BAD-02       --------------------------------------------------
A0A3Q3MLA0_BAD-03       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-02       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WIZ8_BAD-02       --------------------------------------------------
A0A3P8WIZ8_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-02       --------------------------------------------------
A0A3P9A5G8_BAD-01       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A3B5K831_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-02       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A3B1JXK6_BCL2L11      ---------------------------YI---------------------
A0A3B4BVX1_BCL2L11      ---------------------------YV---------------------
A0A3B4BVX1_BCL2L11      --------------------------------------ELWPLYNHHPPH
A0A3B4BVX1_BCL2L11      ---------------------------IAEARGNAQTFELWPLYNHHPPH
A0A3P8XIA2_BCL2L11      ---------------------------LSKPQDTWRG---YEAWPTPHHP
A0A3Q1ICY2_BCL2L11      ---------------------------LAEANGSDLR-T-HQQHGSDLSS
A0A3Q3K6I5_BCL2L11      ---------------------------MAEAHGGRPG-T-HRQDASSPSP
A0A3B4V919_BCL2L11      ---------------------------MAEAHGGGAR-MQQQH-------
A0A3B4XZH1_BCL2L11      ---------------------------MAEAHGGGAR-MQQQQHGEHRH-
A0A3Q3ESW6_BCL2L11      ---------------------------MTEAHGGGPG-T-QQQYGHSPSL
A0A3Q2SZH6_BCL2L11      ---------------------------MAAEHGGQPA-RILGLHGHSFSA
A0A3B3VNE0_BCL2L11      ---------------------------MAVEHGG------LGLHGHSPNH
A0A3B3YII5_BCL2L11      ---------------------------MAVEHGG------LGLHGHSPNH
A0A3B3YII5_BCL2L11      ---------------------------MAVEHGG------LGLHGHSPNH
A0A3P9N073_BCL2L11      ---------------------------MAVEHEIPKL-N-VKGKEEKGGR
A0A3Q3B113_BCL2L11      ---------------------------MAVEQGGGPG-T-HRLHGSSPNP
A0A3B5M375_BCL2L11      ---------------------------MAVEHGG------LGLQGEQT--
A0A3B5QAM1_BCL2L11      ---------------------------MAVEHGG------LGLHGQSPNH
A0A3B5QAM1_BCL2L11      ---------------------------MAVEHGG------LGLHGQSPNH
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A3Q3MLA0_BAD-01       --------------------------------------------------
G1SS60_BAD-01           --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z697_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0C1_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2I3MCN5_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-02       --------------------------------------------------
F7GVS7_BAD-02           --------------------------------------------------
A0A2K6E7J3_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-03       --------------------------------------------------
A0A2K5HKW9_BAD-02       --------------------------------------------------
A0A2K6N1A1_BAD-02       --------------------------------------------------
A0A2K6PUM5_BAD-02       --------------------------------------------------
A0A2K5M0C1_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-03       --------------------------------------------------
F7GVS7_BAD-03           --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2I3MCN5_BAD-02       --------------------------------------------------
A0A2K6E7J3_BAD-03       --------------------------------------------------
A0A2I2Z8C7_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z697_BAD-03       --------------------------------------------------
F6SJL0_BAD-02           --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G3VRY4_BAD-02           --------------------------------------------------
G3VRY4_BAD-01           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
O35147_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A2K5E6K7_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5M0C1_BAD-01       --------------------------------------------------
A0A2K5VCD8_BAD-01       --------------------------------------------------
F7GVS7_BAD-01           --------------------------------------------------
A0A2K6E7J3_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2I3MCN5_BAD-04       --------------------------------------------------
A0A2K6N1A1_BAD-01       --------------------------------------------------
A0A2K6PUM5_BAD-01       --------------------------------------------------
A0A2K5HKW9_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F6SJL0_BAD-01           --------------------------------------------------
A0A2I3MCN5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z697_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
I3MBM5_BAD-01           --------------------------------------------------
I3MBM5_BAD-02           --------------------------------------------------
Q61337_BAD-05           --------------------------------------------------
Q61337_BAD-04           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
Q61337_BAD-06           --------------------------------------------------
Q61337_BAD-02           --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
Q9BXH1_BBC3-03          GRSSALAL-A-GGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDR
F6TGJ4_BMF-01           HAGYLLYL-P-QNSPA--RFGEEV--------------------------
A0A452H3N6_BMF-01       NAGYRLHVPP-VGFALNPHLQEEP--------------------------
G1PAU1_BMF-01           NAGYRLPL-P-ASFPAGSPLGEQP--------------------------
A2AV74_BMF-02           NAGYRLPL-P-ASFPAGSPLGEQP--------------------------
A0A286XXB0_BMF-03       NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
I3MDS9_BMF-02           NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
A0A287AIU8_BMF-05       NAGYRLPL-P-AGFPAGLPLGEQP--------------------------
A0A287AIU8_BMF-04       NAGYRLPL-P-AGFPAGLPLGEQP--------------------------
A0A287AIU8_BMF-03       NAGYRLPL-P-AGFPAGLPLGEQP--------------------------
A0A287AIU8_BMF-01       NAGYRLPL-P-AGFPAGLPLGEQP--------------------------
A0A287AIU8_BMF-02       NAGYRLPL-P-AGFPAGLPLGEQP--------------------------
A0A2K5KGR6_BMF-01       PAEPKSRV-V-ADPPL-------P--------------------------
A0A2K6FFR1_BMF-02       PAEPKSHV-V-ADPPL-------P--------------------------
M3WRS0_BMF-02           PAKPPSSV-V-ADSPL-------P--------------------------
A0A2K5E1W9_BMF-02       SAEPKSRV-V-AGPPL-------S--------------------------
F7HPK0_BMF-02           PAEPKSHV-V-AGPPL-------P--------------------------
A0A2K6TW86_BMF-03       PAEPKSCV-V-AGPPL-------P--------------------------
A0A2K6RAW8_BMF-02       PAEPKSRV-V-ADPPL-------P--------------------------
G3QIN5_BMF-02           PAEPKSCV-V-ADPPL-------P--------------------------
Q96LC9_BMF-07           PAEPKSCV-V-ADPPL-------P--------------------------
Q96LC9_BMF-05           PAEPKSCV-V-ADPPL-------P--------------------------
A0A2R9BS98_BMF-02       PAEPKSCV-V-ADPPL-------P--------------------------
A0A2J8QDD5_BMF-01       PAEPKSCV-V-ADPPL-------P--------------------------
A0A2K5MJY6_BMF-01       PAEPKSRV-V-ADPPL-------P--------------------------
G7PAW6_BMF-01           PAEPKSRV-V-ADPPL-------P--------------------------
A0A2K6B5G4_BMF-03       PAEPKSRV-V-ADPPL-------P--------------------------
A0A2K5Z4C3_BMF-02       PAEPKSRV-V-ADPPL-------P--------------------------
A0A096NTE9_BMF-03       PAEPKSRV-V-ADPPL-------P--------------------------
A0A2I3HD83_BMF-01       PAEPKSRV-V-ADPPL-------P--------------------------
A2AV74_BMF-01           NAGYRLPL-P-ASFPAGSPLGEQP--------------------------
Q8K589_BMF-01           NAGYRLPL-P-ASFPAGSALGEQP--------------------------
I3MDS9_BMF-01           NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
G3T7Z4_BMF-01           NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
F6X3N6_BMF-01           NAGYRLPL-P-ASFPASLRLGEEP--------------------------
G3WDQ2_BMF-01           NAGYRLPL-P-ANFPSSLRLGAEP--------------------------
Q96LC9_BMF-06           NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
F6TJI0_BMF-02           NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
F6TJI0_BMF-01           NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
A0A286XXB0_BMF-02       NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
J9PB65_BMF-01           NAGYRLPL-P-ASFPAGLPLLEQP--------------------------
A0A286XXB0_BMF-01       NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
G1SR62_BMF-01           NAGYRLPL-P-ASFPANFALGEQP--------------------------
W5QFV1_BMF-01           NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
Q05KI3_BMF-01           HAGYRLPL-P-ASFPAGLPLGEQP--------------------------
Q05KI3_BMF-02           HAGYRLPL-P-ASFPAGLPLGEQP--------------------------
A0A452F2E0_BMF-02       NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
A0A452F2E0_BMF-01       NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
M3WRS0_BMF-01           NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
A0A2U4BC98_BMF-01       NAGYRLPL-P-AGFPAGLPLGEQP--------------------------
M3YAD5_BMF-01           NAGYRLPL-P-ASFPAGLPLGDQP--------------------------
A0A452SED0_BMF-01       NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
A0A384D070_BMF-01       NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
A0A2K6FFR1_BMF-01       NAGYRLPL-P-ASFPAGLPLGEQP--------------------------
H0WYH6_BMF-01           NVGYRLPL-P-ASFPAGLPIGEQP--------------------------
A0A096NTE9_BMF-01       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A2K6L933_BMF-02       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A096NTE9_BMF-02       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A2K5MJY6_BMF-02       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A2K5KGR6_BMF-02       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
G7PAW6_BMF-02           NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
F7CM09_BMF-02           NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A2K6B5G4_BMF-01       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A2K6B5G4_BMF-02       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A2K6B5G4_BMF-04       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A2K5Z4C3_BMF-01       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A2K6L933_BMF-03       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A2K6L933_BMF-01       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A2K6RAW8_BMF-01       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A0D9R4R5_BMF-01       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
F7HPK0_BMF-01           NAGYRLPL-P-ASFPAVLPLGEQP--------------------------
A0A2K5E1W9_BMF-01       NAGYRLPL-P-ASFPAVLPLGEQP--------------------------
A0A2K6TW86_BMF-02       NAGYRLPL-P-ASFPAVLPLGEQP--------------------------
A0A2K6TW86_BMF-01       NAGYRLPL-P-ASFPAVLPLGEQP--------------------------
G3QIN5_BMF-01           NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
Q96LC9_BMF-01           NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
Q96LC9_BMF-04           NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
Q96LC9_BMF-03           NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
Q96LC9_BMF-02           NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A2R9BS98_BMF-01       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A2J8QDD5_BMF-02       NAGYRLPL-P-ASFPAVLPIGEQP--------------------------
A0A2J8T301_BMF-01       NAGYRLPL-P-ASFPAVLPTGEQP--------------------------
H9GL49_BMF-01           NAGYRLHVSP-IGFSLNPHFQEEP--------------------------
K7FRX2_BMF-01           NAGYRLHEPP-VGFALNPHLQEEP--------------------------
A9XRG9_BMF-01           NAGYRLHVPP-VGFALDPNLQEEP--------------------------
A9XRG9_BMF-02           NAGYRLHVPP-VGFALDPNLQEEP--------------------------
U3JS06_BMF-01           SAGYRLHVPP-AGFVLDPHLQEEP--------------------------
H0ZMX5_BMF-01           SAGYRLHVPP-AGFVLDPHLQEEP--------------------------
A9XRG9_BMF-03           NAGYRLHVPP-VGFALDPNLQEEP--------------------------
A9XRG9_BMF-04           NAGYRLHVPP-VGFALDPNLQEEP--------------------------
G1NHG8_BMF-01           NAGYRLHVPP-VGFALDPNLQEEP--------------------------
A0A3B4UNJ0_BMF-01       WVPHWELS-PSTKMNMLRFSENRPEE------------------------
B2KKY9_BCL2L11-01       DSDSVPGS-P-LMPNISEAQDGQNDE-VWLSEHSHQHLQ-----------
B8JK68_BCL2L11-01       DSDSVPGS-P-LMPNISEAQDGQNDE-VWLSEHSHQHLQ-----------
A0A3B4B6Y3_BMF-01       -----------AHFELGEDQEASESLQEGEMQNGREPLP-----------
Q0GKC7_BMF-01           NAELLVLA-A----------SSRAQPPDVVLRQNVSPME-----------
A0A3B3RH63_BMF-01       SAGLRLHF-P-ALSVPGGHPPQEERQ------------------------
W5N4P7_BMF-01           NAAFRLHF-P-AHFEQGGDEEEETGE------------------------
A0A3B1K1X5_BMF-01       SAGLLLLA-PSARSERVGDAMFREEH--------RAVEP-----------
A0A3B4CNJ8_BMF-01       SAGLLLLA-PSVRPEHVEGAMLQEDQ--------LAMEP-----------
A0A2U9CJH3_BMF-01       NAGFRLHF-P-AHFELFGDQEVRGHE-SEEERSGMEQLPR----------
A0A3Q2YCX7_BMF-01       NAGFRLHF-P-AHFELVGEQEERLQESDDGMEQQLQQQQ-----------
A0A3Q2YCX7_BMF-02       NAGFRLHF-P-AHFELVGEQEERLQESDDGMEQQLQQQQ-----------
A0A3P8ZIE7_BMF-01       NAGFRLHF-P-AQFECVGDPGPQQRP--QAVRGGMEH-------------
A0A3Q3QZ16_BMF-01       NAGFRLHF-P-AHFELVGDQEARRQE----DQNGMEHLP-----------
A0A3Q3QZ16_BMF-02       NAGFRLHF-P-AHFELVGDQEARRQE----DQNGMEHLP-----------
A0A3Q2PJX9_BMF-02       NAGFRLHF-P-AHFELVGDFDARRQE----EQNRMEPLP-----------
A0A3Q2PJX9_BMF-03       NAGFRLHF-P-AHFELVGDFDARRQE----EQNRMEPLP-----------
A0A3Q2PJX9_BMF-01       NAGFRLHF-P-AHFELVGDFDARRQE----EQNRMEPLP-----------
A0A3B5QK08_BMF-01       NAGFRLHF-P-AHFELVGDFDARQQE----EQNRMEQLP-----------
A0A3B5QK08_BMF-02       NAGFRLHF-P-AHFELVGDFDARQQE----EQNRMEQLP-----------
A0A096LRV0_BMF-01       NAGFRLHF-P-AHFELVGDFDARQQE----EQNRMEQLP-----------
A0A3B3WU80_BMF-01       NAGFRLHF-P-AHFELVGDFDARQQE----EQNRMEQLP-----------
A0A3P9Q8E2_BMF-01       NAGFRLHF-P-AHFELVRDFDARQQE----EQNRMEQLP-----------
A0A3Q2E3E8_BMF-02       NAGFRLHF-P-AHFELVGDFDVRRQA----EHNRMEQLP-----------
A0A3Q2E3E8_BMF-01       NAGFRLHF-P-AHFELVGDFDVRRQA----EHNRMEQLP-----------
A0A3Q3GUU5_BMF-01       NAGFRLHF-P-ANFELVGDQEESGQE-SELQQIGMEQ-------------
A0A3B5B8F6_BMF-01       NAGFRLHF-P-ARFELIGDHQARQQQGSEMEQNGMEQLP-----------
A0A3P8UA78_BMF-01       NAGFRLHF-P-AHFELIGDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQ-
A0A3P8UA78_BMF-03       NAGFRLHF-P-AHFELIGDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQ-
A0A3P8UA78_BMF-02       NAGFRLHF-P-AHFELIGDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQ-
A0A3B3CGR9_BMF-01       NAGFRLHF-P-ARFELAGDLEARRHD-REAERGGMERLP-----------
A0A3B3I0V9_BMF-04       NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP-----------
A0A3B3I0V9_BMF-02       NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP-----------
A0A3B3I0V9_BMF-01       NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP-----------
A0A3B3I0V9_BMF-03       NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP-----------
A0A3P9JM16_BMF-03       NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP-----------
A0A3P9JM16_BMF-02       NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP-----------
A0A3P9JM16_BMF-01       NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP-----------
A0A3Q2ZA20_BMF-01       NAGFRLHF-P-ARFELIRDLEARQQD-REEEPNRMERLP-----------
A0A3P8NFE2_BMF-02       NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP-----------
I3K2D6_BMF-01           NAGFRLHF-P-ARFELVGDHRARRQE-IAEQQNSMERLP-----------
A0A3P8NFE2_BMF-01       NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP-----------
A0A3Q3C5V2_BMF-01       NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP-----------
A0A3P9DPJ5_BMF-02       NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP-----------
A0A3P9DPJ5_BMF-01       NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP-----------
A0A3B4ETH0_BMF-01       NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP-----------
A0A3Q4G1I4_BMF-01       NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP-----------
A0A3Q1FVH7_BMF-01       NAGFRLHF-P-AHFELI----ARQQG-SEMEQNGMEQLP-----------
A0A3Q1FVH7_BMF-02       NAGFRLHF-P-AHFELI----ARQQG-SEMEQNGMEQLP-----------
A0A3Q1D1K3_BMF-01       NAGFRLHF-P-ARFELIGNHQARQQG-SEMEQNGMEQLP-----------
A0A3P8RKY9_BMF-01       NAGFRLHF-P-ARFELIGNHQARQQG-SEMEQNGMEQLP-----------
A0A3Q1IPR4_BMF-01       NAGFRLHF-P-AHFELVGDLEVRQQD-SEEEQNGMEIPP-----------
A0A3B4U5H8_BMF-01       NAGFRLHF-P-AHFELVGDQEARRQG-SGEERNGMEQLP-----------
A0A3B4WM88_BMF-01       NAGFRLHF-P-AHFELVGDQEARRQG-SGEERNGMEQLP-----------
A0A3Q3LME3_BMF-01       NAGFRLHF-P-AHFELVGDQEVRQQE-REEEQNRMEQLP-----------
A0A3Q3LME3_BMF-02       NAGFRLHF-P-AHFELVGDQEVRQQE-REEEQNRMEQLP-----------
A0A3Q3LME3_BMF-03       NAGFRLHF-P-AHFELVGDQEVRQQE-REEEQNRMEQLP-----------
A0A3Q3VLX6_BMF-01       TSSLAPDS----------------RD-NCRERNGMERLP-----------
A0A3B5KWG6_BMF-01       EAGDTLHY----------------TG-GA--PNGMEPLP-----------
A0A286XF37_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
F6Z067_BAD-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
F1PUF4_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
Q4KMV9_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-03       --------------------------------------------------
A0A452FCS1_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-03       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A452FCS1_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-02       --------------------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-01       --------------------------------------------------
                                                                          

A0A287AZR7_PMAIP1-      -----------------CRIGLRRVGTK---------L------------
G1MV54_BCL2L11-01       -----------------IAQELRRIGDE---------FNASY-CPRRGFL
G1PDJ5_BCL2L11-01       -----------------IAQELRRIGDE---------FNNSYRNPRRDFL
A0A452J430_PMAIP1-      -----------------CSLQLRKIGDI---------C--NL--------
A0A1D5PAR2_PMAIP1-      -----------------CALELRRIGDK---------A--DL--------
A0A2K6EM90_PMAIP1-      -----------------CALQLRRLGDK---------L--HF--------
G1P8F9_PMAIP1-01        -----------------CALQLRRIGDK---------L--SF--------
Q9JM54_PMAIP1-03        -----------------CA-QLRRIGDK---------V--NL--------
A0A3Q2I0H2_PMAIP1-      -----------------CAIQIRRIGDK---------L--NF--------
G3T0P7_PMAIP1-01        -----------------CAIQLRRIGDK---------I--NF--------
Q1PCT2_PMAIP1-01        -----------------CAIQLRKFGDK---------L--NF--------
G1LIZ7_PMAIP1-01        -----------------CAIQLRRFGDK---------L--NF--------
A0A452STA4_PMAIP1-      -----------------CAIQLRRFGDK---------L--NF--------
A0A2K5NJZ2_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
A0A0D9S003_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
A0A2K5VPX2_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
A0A2K6BV75_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
A0A2K5ZWH1_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
A0A096MPU8_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
A0A2K5JY52_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
A0A2K6KJF2_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
A0A2K6NC45_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
A0A2K6S6C4_PMAIP1-      -----------------CAIQLRRFGDK---------L--NF--------
A0A2I2YVQ5_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
Q13794_PMAIP1-01        -----------------CATQLRRFGDK---------L--NF--------
A0A2R9AKC9_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
A0A2I3SX38_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
H2NWG2_PMAIP1-01        -----------------CATQLRRFGDK---------L--NF--------
A0A2K5CFK7_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
F7GW45_PMAIP1-01        -----------------CATQLRRFGDK---------L--NF--------
A0A337SUX1_PMAIP1-      -----------------CAMQLRRFGDK---------L--NF--------
A0A3Q1NFP6_PMAIP1-      -----------------CAIQLRRIGDK---------L--NF--------
A0A452EST2_PMAIP1-      -----------------CAIQLRRIGDK---------L--NF--------
W5P738_PMAIP1-01        -----------------CAIQLRRIGDK---------L--NF--------
Q9JM54_PMAIP1-02        -----------------CA-QLRRIGDK---------V--NL--------
A0A2I3HX97_PMAIP1-      -----------------CATQLRRFGDK---------L--NF--------
A0A452TE71_PMAIP1-      -----------------CAIQLRRFGDK---------L--NF--------
A0A0P0HZF9_PMAIP1-      -----------------CAQQLRTIGDL---------F--DW--------
Q0GKC8_PMAIP1-01        -----------------CAQQLRNIGDL---------L--NW--------
Q6JTU4_BCL2L11-01       -----------------IAQELRRIGDE---------FNAYY--------
A0A3B5RFA9_PMAIP1-      -----------------CARELRQVGDK---------L--YW--------
K7E5Y2_BBC3-01          GVLGPEHGDQGEQQDREIGAQLRRMADD---------LNALYEQRRREEE
A9XRH0_BMF-01           -QVWWQLFLFLHNLALNVEANRNRTGQR----------------------
R4G9R5_BCL2L11-01       LRLLHYIVRFIWRMQ-----------------------------------
A3KND0_BMF-01           ASIPHESHRFHRLFQV----------------------------------
Q6P7C5_BAD-01           SHVP----------------------------------------------
A0A287AEF3_BAD-02       SSAPSAADRSRRPPSSGLHSVMAASSGG----------------------
Q9BXH1_BBC3-04          ------------------GDFLCTM-------------------------
A0A2K5F6X4_BBC3-02      ------------------GAQLRRMADD---------LNAQYERRRQEE-
A0A337SQV0_BBC3-03      ------------------GAQLRRMADD---------LNALYERRRQEE-
A0A3P8RLE2_BCL2L11      ------------------KHALERMTDEAHGGGPGTQQHGELRLTYTREI
A0A3B1JLM2_BAD-01       ------------------GRQLRRMSDE---------FDTWLDKGDLRRT
A0A3Q2LHE3_BIK-02       ------------------GVAVYSLAFT---------YNQTGLRGVFRSF
E7FBJ6_BAD-01           ------------------GRQLRRMSDE---------FDTWLDKGVSK--
B5XEF1_BAD-01           ------------------GCQLRRMSDE---------FDTWLDKGVPKRG
H3D8J8_BAD-01           ------------------GRQLRRMSDE---------FDSLLDKGGMRKT
A0A3B5L9R9_BAD-01       ------------------GRQLRRMSDE---------FVNLLDKGEMRNV
Q9GL49_PMAIP1-01        ------------------GARVRGLSSRSFAAKFRLLFAEMPGRRSRRNT
A0A3B1IH05_BAD-01       ------------------GRQLRKMSDE---------FDKGLEQG-MKRV
A0A3Q2QC80_BAD-01       ------------------GRQLRRMSDE---------FGSLLDKGELRKV
A0A3Q3MLA0_BAD-02       ------------------GRQLRRMSDE---------FDILLDKGVRIKG
A0A3Q3MLA0_BAD-03       ------------------GRQLRRMSDE---------FDILLDKGEMKKV
I3K7B6_BAD-01           ------------------GQKLRRMSDE---------FDSLLDKGEMK--
A0A3P9B2E4_BAD-01       ------------------GRQLRRMSDE---------FDSLLDKG-----
A0A3Q3C680_BAD-01       ------------------GRQLRRMSDE---------FDSLLDKGEMK--
A0A3P8QRJ7_BAD-01       ------------------GRQLRRMSDE---------FDSLLDKGEMK--
A0A3Q4GGN3_BAD-01       ------------------GRQLRRMSDE---------FDSLLDKGEMK--
A0A3B4GXJ6_BAD-01       ------------------GRQLRRMSDE---------FDSLLDKGEMK--
A0A3Q2D5S0_BAD-01       ------------------GRQLRRMSDE---------FVTLLDKGELRKV
A0A3B3BQF7_BAD-01       ------------------GQQLRRMSDE---------FDSLLDKGEMRKV
A0A3Q1K1C7_BAD-02       ------------------GQQLRRMSDE---------FDSLLDKGEMRKV
A0A3Q1K1C7_BAD-01       ------------------GQQLRRMSDE---------FDSLLDKGEMRKV
A0A3Q1GWH9_BAD-01       ------------------GQQLRRMSDE---------FDSLLDKGEMKRV
A0A3Q1CPU7_BAD-01       ------------------GQQLRRMSDE---------FDSLLDKGEMKRV
A0A3P8TWH6_BAD-01       ------------------GQQLRRMSDE---------FDSLLDKGEMKRV
A0A2U9BAC9_BAD-01       ------------------GQKLRRMSDE---------FDSLLDKGEMRKV
A0A3B4VFC5_BAD-01       ------------------GQKLRRMSDE---------FDSLLDKGEMRKV
A0A3B4W9T1_BAD-01       ------------------GQKLRRMSDE---------FDSLLDKGEMRKV
A0A3Q0QNQ2_BAD-01       ------------------GQQLRRMSDE---------FDSLLDKG-MKKA
A0A3P8WIZ8_BAD-02       ------------------GRQLRRMSDE---------FDSLLDKG-MRKV
A0A3P8WIZ8_BAD-01       ------------------GRQLRRMSDE---------FDSLLDKG-MRKV
A0A3P9A5G8_BAD-02       ------------------GCQLRRMSDE---------FDTWLDKGEPKRG
A0A3P9A5G8_BAD-01       ------------------GCQLRRMSDE---------FDTWLDKGEPKRG
B5X1T1_BAD-01           ------------------GRQLRRMSDE---------FDTWLDKGEPKRG
H3ANP3_BAD-03           ------------------GQELRRMSDE---------FD--MSFLGLPRP
H3ANP3_BAD-04           ------------------GQELRRMSDE---------FD--MSFLGLPRP
H3ANP3_BAD-02           ------------------GQELRRMSDE---------FD--MSFLGLPRP
H3ANP3_BAD-01           ------------------GQELRRMSDE---------FD--MSFLGLPRP
A0A3B3QX41_BAD-01       ------------------GRQLRRMSDE---------FDTLLDKG-MKRV
Q4V925_BAD-02           ------------------GQQLRRMSDE---------F----DKG-MKRV
Q4V925_BAD-03           ------------------GQQLRRMSDE---------F----DKG-MKRV
A7MCM4_BAD-01           ------------------GQQLRRMSDE---------F----DKGQMKRV
Q4V925_BAD-04           ------------------GQQLRRMSDE---------F----DKGQMKRV
Q4V925_BAD-01           ------------------GQQLRRMSDE---------F----DKGQMKRV
A0A3P8Y761_BAD-01       ------------------GRQLRRMSDE---------FDTWLDKGQMKRV
A0A3B5K831_BAD-01       ------------------GRQLRRMSDE---------FDSLLDKGGMRKT
A0A3B5Q2N7_BAD-01       ------------------GRQLRRMSDE---------FVNLLDKGEMRNV
A0A087X8P8_BAD-01       ------------------GRQLRRMSDE---------FVNLLDKGEMRKV
A0A3B3UA11_BAD-01       ------------------GRQLRRMSDE---------FVNLLDKGEMRKV
A0A3B3YFR1_BAD-01       ------------------GRQLRRMSDE---------FVNLLDKGEMRKV
A0A3P9Q7C3_BAD-01       ------------------GRQLRRMSDE---------FVNLLDKGEMRKV
A0A3B3HDU2_BAD-01       ------------------GQQLRRMSDE---------FDSLLDKGEMRKV
A0A3B5BAL2_BAD-01       ------------------GQKLRRMSDE---------FDSLLDKGEMKRV
A0A3Q3AEL8_BAD-02       ------------------GRQLRRMSDE---------FDSLLDKGEMRKV
A0A3Q3AEL8_BAD-01       ------------------GRQLRRMSDE---------FDSLLDKGEMRKV
G3Q8B3_BAD-01           ------------------GRQLRRMSDE---------FDSLLDKGEMRRV
A0A3Q2Y0E4_BAD-01       ------------------GRQLRRMSDE---------FDSLMDKGELKFK
A0A3Q3R5S3_BAD-01       ------------------GRQLRRMSDE---------FDSLLDKGEMKRV
A0A3Q3RXS8_BAD-02       ------------------GQQLRRMSDE---------FDSLLDKGEMR-V
A0A3Q3RXS8_BAD-01       ------------------GQQLRRMSDE---------FDSLLDKGEMR-V
A0A3Q0QNQ2_BAD-02       ------------------GQQLRRMSDE---------FDSLLDKGMKK-A
A0A3Q3WTY4_BAD-01       ------------------GQRLRRMSDE---------F----DRQEWK-T
A0A3B1JXK6_BCL2L11      ------------------AQELRRIGDE---------FNDLYFRGAGR-N
A0A3B4BVX1_BCL2L11      ------------------AQELRRIGDE---------FNELYFHGVSQLH
A0A3B4BVX1_BCL2L11      GA----APAGDMRPESYVAQELRRIGDE---------FNELYF-------
A0A3B4BVX1_BCL2L11      GA----APAGDMRPESYVAQELRRIGDE---------FNELYF-------
A0A3P8XIA2_BCL2L11      YRPRPPPIAGDMRPEILIGQELQRIGDE---------FNNLFIHGRLGAR
A0A3Q1ICY2_BCL2L11      SSTQQQNAAGDMQAVEV-GRELRRIGDD---------FNNHLL--EVAGR
A0A3Q3K6I5_BCL2L11      SSARQQNAIRDMQAEAV-GRELRRIGDD---------YNNHLL--ELADR
A0A3B4V919_BCL2L11      --------------------------GE---------LKPALLKHTKMTS
A0A3B4XZH1_BCL2L11      ------FASGDMQAEAV-GQELRRIGDD---------FNRLLLLRVSHHR
A0A3Q3ESW6_BCL2L11      TSRRQRTAAGDMQAEAI-GRDLQRIGDD---------YNRLLLW-RMAGR
A0A3Q2SZH6_BCL2L11      RQG---NAARDMQPERF-GRQLRAIGDE---------YNNHLM--RMAGR
A0A3B3VNE0_BCL2L11      YSTI--NAARDMQSETF-GRQLRAIGDD---------YNNHLMVRRMARR
A0A3B3YII5_BCL2L11      YSTI--NAARDMQSENF-GRQLRAIGDD---------YNNHLM--RMARR
A0A3B3YII5_BCL2L11      YSTI--NAARDMQSENF-GRQLRAIGDD---------YNNHLM--RMARR
A0A3P9N073_BCL2L11      GGAFVIIPKRETNQPIL-SC------------------------------
A0A3Q3B113_BCL2L11      SGTQARNAAGDMEAESF-GRHLRTIGDE---------YNRLLLLRRMAGR
A0A3B5M375_BCL2L11      -SVL--PPPPSETSTTW-EQ------------------------------
A0A3B5QAM1_BCL2L11      YSTI--NAARDMQSETY-GRQLRAIGDE---------YNNLLMGRRMARG
A0A3B5QAM1_BCL2L11      YSTI--NAARDMQSETY-GRQLRAIGDE---------YNNLLMGRRMARG
A0A2I3HWI8_BBC3-03      ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A2K6FQZ3_BBC3-04      ------------------GAQLRRMADD---------LNAQYERR-RQEE
Q9BXH1_BBC3-05          ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A2R9BZA9_BBC3-01      ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A2I3RGH5_BBC3-03      ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A2K5P2T8_BBC3-03      ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A2K5V8J3_BBC3-03      ------------------GAQLRRMADD---------LNAQYERR-RQEE
F7FFP6_BBC3-03          ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A2K6ASP2_BBC3-03      ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A2I3N2Z9_BBC3-03      ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A2K6QZU4_BBC3-04      ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A2R8MW85_BBC3-03      ------------------GAQLRRMADD---------LNALYERR-RQEE
A0A2K6STD6_BBC3-02      ------------------GAQLRRMADD---------LNAQYERR-RQEE
G3T2N1_BBC3-01          ------------------GAQFRRKADD---------LYALYERSVRQEE
M3Y0R3_BBC3-01          ------------------GAQLRRMADD---------LNALYERR-RQEE
Q99ML1_BBC3-02          ------------------GAQLRRMADD---------LNAQYERR-RQEE
Q80ZG6_BBC3-01          ------------------GAQLRRMADD---------LNAQYERR-RQEE
H0XQ00_BBC3-01          ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A3Q2GWE8_BBC3-01      ------------------GAQLRRMADD---------LNALYERR-RQEE
A0A3Q1LXZ6_BBC3-01      ------------------GAQLRRMADD---------LNALYERR-RQEE
A0A452E3G1_BBC3-01      ------------------GAQLRRMADD---------LNALYERR-RQEE
J9NTK9_BBC3-01          ------------------GAQLRRMADD---------LNALYERR-RQEE
A0A337SQV0_BBC3-02      ------------------GAQLRRMADD---------LNALYERR-RQEE
F1RM01_BBC3-01          ------------------GAQLRRMADD---------LNALYERR-RQEE
A0A2K6FQZ3_BBC3-01      ------------------GAQLRRMADD---------LNAQYERR-RQEE
Q9BXH1_BBC3-06          ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A2I3RGH5_BBC3-01      ------------------GAQLRRMADD---------LNAQYERR-RQEE
H2NZD3_BBC3-01          ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A2K6QZU4_BBC3-01      ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A0D9S2H2_BBC3-01      ------------------GAQLRRMADD---------LNAQYERR-RQEE
B4DQK3_BBC3-01          ------------------GAQLRRMADD---------LNAQYERR-RQEE
A0A3Q3MLA0_BAD-01       ------------------GRQLRRMSDE---------FDILLDKGVRIKG
G1SS60_BAD-01           ------------------GRELRRMSDE---------FEGSVKKGLPRPK
K7E5Y2_BBC3-02          ------------------GAQLRRMADD---------LNALY------EQ
A0A3B4DUY7_BAD-01       ------------------GRQLRRMSDE---------FDTWLDKGDTR--
A0A337SAW2_BAD-01       ------------------GRELRRMSDE---------FQGSF-KGLPRPK
A0A2I3TBK7_BAD-01       --------------------KLRPLPVT---------FAPHP-ETPPVPT
A0A2R8Z697_BAD-02       --------------------KLRPLPVT---------FAPHP-ETPPVPT
A0A2I2Z8C7_BAD-03       --------------------KLRPLPVT---------FAAHP-ETPPVPT
Q92934_BAD-03           --------------------KLRPLPVT---------FAPHP-ETPPVPT
A0A2K5M0C1_BAD-02       --------------------KLRPLPVT---------FAPRP-ETPPALT
A0A2K5XJR2_BAD-02       --------------------KLRPLPVT---------FAPRP-ETPPALT
A0A2I3MCN5_BAD-03       --------------------KLRPLPVT---------FAPRP-ETPPALT
A0A2K5VCD8_BAD-02       --------------------KLRTLPVT---------FAPRP-ETPPALT
F7GVS7_BAD-02           --------------------KLRTLPVT---------FAPRP-ETPPALT
A0A2K6E7J3_BAD-02       --------------------KLRTLPVT---------FAPRP-ETPPALT
A0A2K5E6K7_BAD-02       --------------------RLRSLPVT---------FAPHP-ETPPVPI
A0A2K6TG62_BAD-02       --------------------RLRSLPVT---------FAPHP-ETLPAPI
A0A2K5E6K7_BAD-03       ------------------NVKLE-VPC----------W---V-ATAPTPQ
A0A2K5HKW9_BAD-02       ------------------NVKLEALGL----------WRPGV-ATAPTPR
A0A2K6N1A1_BAD-02       ------------------NVKLEALGL----------WRPGV-ATAPTPR
A0A2K6PUM5_BAD-02       ------------------NVKLEALGL----------WRPGV-ATAPTPR
A0A2K5M0C1_BAD-03       ------------------NVKLKALGL----------WRPGV-ATAPTPR
A0A2K5VCD8_BAD-03       ------------------NVKLKALGL----------WRPGV-ATAPTPR
F7GVS7_BAD-03           ------------------NVKLKALGL----------WRPGV-ATAPTPR
A0A2K5XJR2_BAD-03       ------------------NVKLKALGL----------WRPGV-ATAPTPR
A0A2I3MCN5_BAD-02       ------------------NVKLKALGL----------WRRGV-ATAPTPR
A0A2K6E7J3_BAD-03       ------------------NVKLKALGL----------WRPAV-ATAPTPR
A0A2I2Z8C7_BAD-04       ------------------NVKLEALGL----------WRSGV-ATAPTPR
Q92934_BAD-04           ------------------NVKLEALGL----------WRSGV-ATAPTPR
A0A2I3TBK7_BAD-03       ------------------NVKLEALGL----------WRSGV-ATAPTPR
A0A2R8Z697_BAD-03       ------------------NVKLEALGL----------WRSGV-ATAPTPR
F6SJL0_BAD-02           ------------------NVKLEALGL----------WRPGV-ATARTPQ
A0A2K6TG62_BAD-03       ------------------NVKLEALEP----------WRHGV-ATARTPQ
G3VRY4_BAD-02           ------------------GSELRRMSDE---------FHCTF-KGLPRPK
G3VRY4_BAD-01           ------------------GSELRRMSDE---------FHCTF-KGLPRPK
G1P8C5_BAD-01           ------------------GRELRRMSDE---------FQGSFKKGLPRPK
A0A452ER54_BAD-02       ------------------GRELRRMSDE---------FHVSF-KGLPRPK
W5P8G9_BAD-01           ------------------GRELRRMSDE---------FHVSF-KGLPRPK
G3TP47_BAD-01           ------------------GRELRRMSDE---------FQGYF-KGLPRPK
G1MI17_BAD-01           ------------------GRELRRMSDE---------FQGSF-KGLPRPK
A0A287AEF3_BAD-01       ------------------GRELRRMSDE---------FQGSF-KGLPRPK
M3YNE7_BAD-01           ------------------GRELRRMSDE---------FQGSF-KGLPRPK
A0A452RJM6_BAD-01       ------------------GRELRRMSDE---------FQGSF-KGLPRPK
A0A384DJL2_BAD-01       ------------------GRELRRMSDE---------FQGSF-KGLPRPK
A0A452ER54_BAD-01       ------------------GRELRRMSDE---------FHVSF-KGLPRPK
F1MUT9_BAD-01           ------------------GRELRRMSDE---------FHVSF-KGLPRPK
Q3SYZ0_BAD-01           ------------------GRELRRMSDE---------FHVSF-KGLPRPK
F7DN67_BAD-01           ------------------GRELRRMSDE---------FQVSF-QALPRPK
O35147_BAD-01           ------------------GRELRRMSDE---------FEGSF-KGLPRPK
H0WVR2_BAD-01           ------------------GRELRRMSDE---------FEDSFKKGLPRPK
H0V608_BAD-01           ------------------GRELRRMSDE---------FVDSF-KGLPRPK
A0A2K5E6K7_BAD-01       ------------------GRELRRMSDE---------FVDSF-KGLPRPK
A0A2K6TG62_BAD-01       ------------------GRELRRMSDE---------FVDSF-KGLPRPK
A0A0D9R491_BAD-01       ------------------GRELRRMSDE---------FVDSF-KGLPRPK
A0A2K5M0C1_BAD-01       ------------------GRELRRMSDE---------FVDSF-KGLPRPK
A0A2K5VCD8_BAD-01       ------------------GRELRRMSDE---------FVDSF-KGLPRPK
F7GVS7_BAD-01           ------------------GRELRRMSDE---------FVDSF-KGLPRPK
A0A2K6E7J3_BAD-01       ------------------GRELRRMSDE---------FVDSF-KGLPRPK
A0A2K5XJR2_BAD-01       ------------------GRELRRMSDE---------FVDSF-KGLPRPK
A0A2I3MCN5_BAD-04       ------------------GRELRRMSDE---------FVDSF-KGLPRPK
A0A2K6N1A1_BAD-01       ------------------GRELRRMSDE---------FVDSF-KGLPRPK
A0A2K6PUM5_BAD-01       ------------------GRELRRMSDE---------FVDSF-KGLPRPK
A0A2K5HKW9_BAD-01       ------------------GRELRRMSDE---------FVDSF-KGLPRPK
B4DZQ9_BAD-01           ------------------GRELRRMSDE---------FVDSFKKGLPRPK
A0A2K6GWV0_BAD-01       ------------------GRELRRMSDE---------FEDSFKKGLPRPK
F6SJL0_BAD-01           ------------------GRELRRMSDE---------FVDSFKKGLPRPK
A0A2I3MCN5_BAD-01       ------------------GRELRRMSDE---------FVDSFKKGLPRPK
A0A2I2Z8C7_BAD-02       ------------------GRELRRMSDE---------FVDSFKKGLPRPK
A0A2I2Z8C7_BAD-01       ------------------GRELRRMSDE---------FVDSFKKGLPRPK
Q92934_BAD-01           ------------------GRELRRMSDE---------FVDSFKKGLPRPK
Q92934_BAD-02           ------------------GRELRRMSDE---------FVDSFKKGLPRPK
A0A2I3TBK7_BAD-02       ------------------GRELRRMSDE---------FVDSFKKGLPRPK
A0A2R8Z697_BAD-01       ------------------GRELRRMSDE---------FVDSFKKGLPRPK
A0A2J8TYJ3_BAD-01       ------------------GRELRRMSDE---------FVDSFKKGLPRPK
F1PK10_BAD-01           ------------------GRELRRMSDE---------FQGSF-KGLPRPK
Q45KI9_BAD-01           ------------------GRELRRMSDE---------FQGSF-KGLPRPK
I3MBM5_BAD-01           ------------------GRELRRMSDE---------FEGSF-KGLPRPR
I3MBM5_BAD-02           ------------------GRELRRMSDE---------FEGSF-K------
Q61337_BAD-05           ------------------GRELRRMSDE---------FEGSF-KVSASVR
Q61337_BAD-04           ------------------GRELRRMSDE---------FEGSF-KGLPRPK
Q61337_BAD-03           ------------------GRELRRMSDE---------FEGSF-KGLPRPK
Q61337_BAD-06           ------------------GRELRRMSDE---------FEGSF-KGLPRPK
Q61337_BAD-02           ------------------GRELRRMSDE---------FEGSF-KG-----
Q61337_BAD-01           ------------------GRELRRMSDE---------FEGSF-KGLPRPK
I3LVX0_BIK-01           ----RPAAPSTRVPPARACRELLPVLLL---------LGLLLSRALYLRL
A0A3G3M2M0_BCL2L11      ----------AMGPEISVARELRRIGDE---------FNRLYCQGAGAGG
A0A3Q1ELG4_BCL2L11      ----------QV-----IRHALERMAGE---------AHR---GGPETQR
A0A3Q1CI15_BCL2L11      ----------QV-----IKHALERMTDE---------AHG---GGPGT--
O61667_EGL1-01          ----------------EIGSKLAAMCDD---------FDAQMMSYSAHAS
Q9BXH1_BBC3-03          GPAAADGGRPQRTVRAAETRGAAAAPPL---------TLEGPV-------
F6TGJ4_BMF-01           ----DNRRQ-EQSAEHRIARKLQCIGDQ---------FHRFHL-------
A0A452H3N6_BMF-01       ----REGQR-EALAEVQIARKLQCIADQ---------FHRLHI-------
G1PAU1_BMF-01           ----PEGQWQHHRAEIQIARKLQSIADQ---------FHRLQM-------
A2AV74_BMF-02           ----PEGQFLQHRAEVQIARKLQCIADQ---------FHRLHT-------
A0A286XXB0_BMF-03       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHI-------
I3MDS9_BMF-02           ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
A0A287AIU8_BMF-05       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
A0A287AIU8_BMF-04       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
A0A287AIU8_BMF-03       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
A0A287AIU8_BMF-01       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
A0A287AIU8_BMF-02       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
A0A2K5KGR6_BMF-01       ----AQPCF-EWRREQERGGPQVRLGCP---------LHMGHQ-------
A0A2K6FFR1_BMF-02       ----TQPCF-ERRREQERGRSQ----------------------------
M3WRS0_BMF-02           ----TQPGF-ECRREQEWGRSQ----------------------------
A0A2K5E1W9_BMF-02       ----AQPGF-EWRREQEWGRPE----------------------------
F7HPK0_BMF-02           ----AQPGF-EWRREQEWGRPE----------------------------
A0A2K6TW86_BMF-03       ----AQPGF-EWRRKQEWGRSE----------------------------
A0A2K6RAW8_BMF-02       ----AQPCF-EWRRE-----------------------------------
G3QIN5_BMF-02           ----AQPCF-EWRREQERGRP-----------------------------
Q96LC9_BMF-07           ----AQPCF-EWRREQERGRP-----------------------------
Q96LC9_BMF-05           ----AQPCF-EWRREQERGRP-----------------------------
A0A2R9BS98_BMF-02       ----AQPCF-EWRREQERGRP-----------------------------
A0A2J8QDD5_BMF-01       ----AQPCF-EWRREQERGRP-----------------------------
A0A2K5MJY6_BMF-01       ----AQPCF-EWRREQERGGP-----------------------------
G7PAW6_BMF-01           ----AQPCF-EWRREQERGGP-----------------------------
A0A2K6B5G4_BMF-03       ----AQPCF-EWRREQERGGP-----------------------------
A0A2K5Z4C3_BMF-02       ----AQPCF-EWRREQERGGP-----------------------------
A0A096NTE9_BMF-03       ----AQPCF-EWRREQERGGP-----------------------------
A0A2I3HD83_BMF-01       ----AQPCF-EWRREQEWGRP-----------------------------
A2AV74_BMF-01           ----PEGQFLQHRAEVQIARKLQCIADQ---------FHRLHT-------
Q8K589_BMF-01           ----PEGQFLQHRAEVQIARKLQCIADQ---------FHRLHM-------
I3MDS9_BMF-01           ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
G3T7Z4_BMF-01           ----PEGQW-QHRAEVQIARKLQCIADH---------FHRLHM-------
F6X3N6_BMF-01           ----PEEQW-EHRAEVQIAQKLQCIADQ---------FHRLHM-------
G3WDQ2_BMF-01           ----PEEQW-EHRAEVQIARKLQCIADQ---------FHRLHM-------
Q96LC9_BMF-06           ----PEGQW-QHQAE-----------------------------------
F6TJI0_BMF-02           ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
F6TJI0_BMF-01           ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
A0A286XXB0_BMF-02       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHI-------
J9PB65_BMF-01           ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
A0A286XXB0_BMF-01       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHI-------
G1SR62_BMF-01           ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHL-------
W5QFV1_BMF-01           ----PEGQW-QHRAEIQIARKLQCIADQ---------FHRLHM-------
Q05KI3_BMF-01           ----PEGQW-QHRAEIQIARKLQCIADQ---------FHRLHM-------
Q05KI3_BMF-02           ----PEGQW-QHRAEIQIARKLQCIADQ---------FHRLHM-------
A0A452F2E0_BMF-02       ----PEGQW-QHRAEIQIARKLQCIADQ---------FHRLHM-------
A0A452F2E0_BMF-01       ----PEGQW-QHRAEIQIARKLQCIADQ---------FHRLHM-------
M3WRS0_BMF-01           ----PEGHW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
A0A2U4BC98_BMF-01       ----AEGQW-QHRAEVQIARKLQRIADQ---------FHRLHM-------
M3YAD5_BMF-01           ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
A0A452SED0_BMF-01       ----PEGPW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
A0A384D070_BMF-01       ----PEGPW-QHRAEVQIARKLQCIADQ---------FHRLHM-------
A0A2K6FFR1_BMF-01       ----AEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
H0WYH6_BMF-01           ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A096NTE9_BMF-01       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2K6L933_BMF-02       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A096NTE9_BMF-02       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2K5MJY6_BMF-02       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2K5KGR6_BMF-02       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
G7PAW6_BMF-02           ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
F7CM09_BMF-02           ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2K6B5G4_BMF-01       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2K6B5G4_BMF-02       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2K6B5G4_BMF-04       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2K5Z4C3_BMF-01       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2K6L933_BMF-03       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2K6L933_BMF-01       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2K6RAW8_BMF-01       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A0D9R4R5_BMF-01       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
F7HPK0_BMF-01           ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2K5E1W9_BMF-01       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2K6TW86_BMF-02       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2K6TW86_BMF-01       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
G3QIN5_BMF-01           ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
Q96LC9_BMF-01           ----PEGQW-QHQAEVQIARKLQCIADQ---------FHRLHV-------
Q96LC9_BMF-04           ----PEGQW-QHQAEVQIARKLQCIADQ---------FHRLHV-------
Q96LC9_BMF-03           ----PEGQW-QHQAEVQIARKLQCIADQ---------FHRLHV-------
Q96LC9_BMF-02           ----PEGQW-QHQAEVQIARKLQCIADQ---------FHRLHV-------
A0A2R9BS98_BMF-01       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2J8QDD5_BMF-02       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
A0A2J8T301_BMF-01       ----PEGQW-QHRAEVQIARKLQCIADQ---------FHRLHV-------
H9GL49_BMF-01           ----QESPQ-ELRTEVQIARKLQCIADQ---------FHRLHL-------
K7FRX2_BMF-01           ----REGHQ-EARAEVQIARKLQCIADQ---------FHRLHI-------
A9XRG9_BMF-01           ----QEGQR-EARTEVQIARKLQCIADQ---------FHRLHI-------
A9XRG9_BMF-02           ----QEGQR-EARTEVQIARKLQCIADQ---------FHRLHI-------
U3JS06_BMF-01           ----QEGQR-EARAEVQIARKLQCIADQ---------FHRLHI-------
H0ZMX5_BMF-01           ----QEGQR-EARAEVQIARKLQCIADQ---------FHRLHI-------
A9XRG9_BMF-03           ----QEGQR-EARTEVQIARKLQCIADQ---------FHRLHI-------
A9XRG9_BMF-04           ----QEGQR-EARTEVQIARKLQCIADQ---------FHRLHI-------
G1NHG8_BMF-01           ----QEGQR-EARTEVQIARKLQCIADQ---------FHRLHI-------
A0A3B4UNJ0_BMF-01       ----Q----AGVSVEAQIGRKLREIGDK---------FQQDHF-------
B2KKY9_BCL2L11-01       ----MAAPVAALPPEMVVARELRRIGDE---------FNRLYCEAGAGVN
B8JK68_BCL2L11-01       ----MAAPVAALPPEMVVARELRRIGDE---------FNRLYCEAGAGVN
A0A3B4B6Y3_BMF-01       ----RHPV-AVRSMEACIGHKLQLIGDQ---------FHRDHLQRV----
Q0GKC7_BMF-01           ----RPEPRPAQSVETLIGQKLQLIGDQ---------FYQEHI-------
A0A3B3RH63_BMF-01       ----PDDR-PQPSAEVRIGQKLQMIGDQ---------FHQDQLQLY----
W5N4P7_BMF-01           ----AEEQ-PVRSAEVRIGQKLQRIGDQ---------FHRDYLHMY----
A0A3B1K1X5_BMF-01       ----RRRP--AHSVEARIGQKLQMIGDQ---------FYQEHMLQ-----
A0A3B4CNJ8_BMF-01       ----RRRP--PHSVEARIGQKLQMIGDQ---------FYQEHMLQ-----
A0A2U9CJH3_BMF-01       ----QQQP-VAHSVEACIGQKLQLIGDQ---------FHREHLQLY----
A0A3Q2YCX7_BMF-01       ----QQQP-VARSIEACVGQKLQLIGDQ---------FHREHLQLV----
A0A3Q2YCX7_BMF-02       ----QQQP-VARSIEACVGQKLQLIGDQ---------FHREHLQLV----
A0A3P8ZIE7_BMF-01       ----PQQL-PQQPVARCIGQKLQLIGDQ---------FHEEHLQLY----
A0A3Q3QZ16_BMF-01       ----RQQR-VARSVEACIGQKLQLIGDQ---------FHREHLQLY----
A0A3Q3QZ16_BMF-02       ----RQQR-VARSVEACIGQKLQLIGDQ---------FHREHLQLY----
A0A3Q2PJX9_BMF-02       ----LHQP-AALSLEACIGQKLQLIGDQ---------FHREHLQQR----
A0A3Q2PJX9_BMF-03       ----LHQP-AALSLEACIGQKLQLIGDQ---------FHREHLQQY----
A0A3Q2PJX9_BMF-01       ----LHQP-AALSLEACIGQKLQLIGDQ---------FHREHLQQY----
A0A3B5QK08_BMF-01       ----LHQP-AALSLEASIGQKLQLIGDQ---------FHREHLQQY----
A0A3B5QK08_BMF-02       ----LHQP-AALSLEASIGQKLQLIGDQ---------FHREHLQQY----
A0A096LRV0_BMF-01       ----LHQP-AALSLEACIGQKLQLIGDQ---------FHREHLQQY----
A0A3B3WU80_BMF-01       ----LHQP-AALSLEACIGQKLQLIGDQ---------FHREHLQQY----
A0A3P9Q8E2_BMF-01       ----LHQP-AALSLEACIGQKLQLIGDQ---------FHREHLQQY----
A0A3Q2E3E8_BMF-02       ----LQQP-AALSLEACIGQKLQIIGDQ---------FHREHLQQIPGQP
A0A3Q2E3E8_BMF-01       ----LQQP-AALSLEACIGQKLQIIGDQ---------FHREHLQQY----
A0A3Q3GUU5_BMF-01       -----QQP-VAHSVEASIGLKLQLIGDQ---------FHREHLQLY----
A0A3B5B8F6_BMF-01       ----RQQP-VARSVEACIGQKLQLIGDQ---------FHREHLQLY----
A0A3P8UA78_BMF-01       ----QQQP-VQRSVEVRIGQKLQLIGDQ---------FHRDHLQLY----
A0A3P8UA78_BMF-03       ----QQQP-VQRSVEVRIGQKLQLIGDQ---------FHRDHLQLY----
A0A3P8UA78_BMF-02       ----QQQP-VQRSVEVRIGQKLQLIGDQ---------FHRDHLQLY----
A0A3B3CGR9_BMF-01       ----RQQP-AARSTEACIAQKLQLIGDQ---------FHRERLQLY----
A0A3B3I0V9_BMF-04       ----RQQP-VARSTEACIAQKLQLIGDQ---------FHRERLQLY----
A0A3B3I0V9_BMF-02       ----RQQP-VARSTEACIAQKLQLIGDQ---------FHRERLQLY----
A0A3B3I0V9_BMF-01       ----RQQP-VARSTEACIAQKLQLIGDQ---------FHRERLQLY----
A0A3B3I0V9_BMF-03       ----RQQP-VARSTEACIAQKLQLIGDQ---------FHRERLQLY----
A0A3P9JM16_BMF-03       ----RQQP-VARSTEACIAQKLQLIGDQ---------FHRERLQLY----
A0A3P9JM16_BMF-02       ----RQQP-VARSTEACIAQKLQLIGDQ---------FHRERLQLY----
A0A3P9JM16_BMF-01       ----RQQP-VARSTEACIAQKLQLIGDQ---------FHRERLQLY----
A0A3Q2ZA20_BMF-01       ----RQLP-VARSLEVCIGQKLQLIGDQ---------FHREHLQQY----
A0A3P8NFE2_BMF-02       ----RQRP-AARSVEACIGQKLQLIGDQ---------FHWERLQLV----
I3K2D6_BMF-01           ----RQRP-AARSVEACIGQKLQLIGDQ---------FHWERLQLY----
A0A3P8NFE2_BMF-01       ----RQRP-AARSVEACIGQKLQLIGDQ---------FHWERLQLY----
A0A3Q3C5V2_BMF-01       ----RQRP-AARSVEACIGQKLQLIGDQ---------FHWERLQLY----
A0A3P9DPJ5_BMF-02       ----RQRP-AARSVEACIGQKLQLIGDQ---------FHWERLQLY----
A0A3P9DPJ5_BMF-01       ----RQRP-AARSVEACIGQKLQLIGDQ---------FHWERLQLY----
A0A3B4ETH0_BMF-01       ----RQRP-AARSVEACIGQKLQLIGDQ---------FHWERLQLY----
A0A3Q4G1I4_BMF-01       ----RQRP-AARSVEACIGQKLQLIGDQ---------FHWERLQLY----
A0A3Q1FVH7_BMF-01       ----RQQP-MAHSVEACIGQKLQLIGDQ---------FHREHLQLY----
A0A3Q1FVH7_BMF-02       ----RQQP-MAHSVEACIGQKLQLIGDQ---------FHREHLQLY----
A0A3Q1D1K3_BMF-01       ----RQQP-VARSMEACIGQKLQLIGDQ---------FHREHLQLY----
A0A3P8RKY9_BMF-01       ----RQQP-VARSMEACIGQKLQLIGDQ---------FHREHLQLY----
A0A3Q1IPR4_BMF-01       ----RQQP-LMQSVEACIGQKLQLIGDQ---------FHREHLQLY----
A0A3B4U5H8_BMF-01       ----RQQP-VARSVEACIGQKLQLIGDQ---------FHREHLQLY----
A0A3B4WM88_BMF-01       ----RQQP-VARSVEACIGQKLQLIGDQ---------FHREHLQLY----
A0A3Q3LME3_BMF-01       ----RQQP-LVHSVEACIGQKLQLIGDQ---------FHREHLQL-----
A0A3Q3LME3_BMF-02       ----RQQP-LVHSVEACIGQKLQLIGDQ---------FHREHLQLY----
A0A3Q3LME3_BMF-03       ----RQQP-LVHSVEACIGQKLQLIGDQ---------FHREHLQLY----
A0A3Q3VLX6_BMF-01       ----RQQP-VAHSVEACIGQKLQLIGDQ---------FHREHMQLY----
A0A3B5KWG6_BMF-01       ----QQGP-VVRSTEACIGQKLQLIGDQ---------FHRERVQLY----
A0A286XF37_PMAIP1-      -------ARARAELEVECAAQLRRIGDK---------LNFQQKLMYLISK
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
F1SMU1_PMAIP1-01        -------------PEVECAIQFRRIGDK---------LNFRQKLLNLIAK
A0A3B3QC78_BCL2L11      ----LSMLPDMR-PEMLVARELRRIGDK---------FNDIYINGVSILL
A0A3Q2U844_BCL2L11      ----HSLAEEIQ-PEIWIAQELRRIGDE---------FNASYCPRRGFLD
G3SU55_BCL2L11-01       ----QALPADLR-PEIWIARELRRIGDE---------FNAYY-PRRAFL-
G3W979_BCL2L11-01       ----QSIPADMR-PEIWIAQELRRIGDE---------FNASY-PRRGFLD
A0A2K6KS56_BBC3-02      ----RAPEMEPN--------------------------------------
A0A3Q3SYA1_BCL2L11      ----GAGAHRQHGEHKHLRSRLFTAHAE---------YTQVKQP------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      ----LGNGRWNTSK------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
C1C3S9_BAD-01           -----PRPKSA----------SAATEMT---------VSKSFGETFFNFF
A0A3B4CPH6_BAD-01       --------------------------------------------------
F6Z067_BAD-01           -----PRPKS-----------ASAAGQM---------TGNRSIRDLIMGL
A0A3Q2LHE3_BIK-01       -----LTRRDR-----VSLRFHDLDSPS---------CMCSPLEPWSSCP
A0A452QUG1_BIK-01       -----LTFRNR----------VSPHPGR---------RLVLSLLLLLGLL
A0A452V3L2_BIK-01       -----LTFRNRGLDLEPSLPATQPQSRS---------SRCSDSPPPAGLV
M3XHJ5_BCL2L11-01       -----PAPVSV----------HKATQTP---------SPSSQLIVHVQHC
W5QCU2_BIK-01           -----LTLRDR----------VSPS--L---------WPELALSLLVVAM
O70337_BIK-04           -----LTPGAW----------VSPDQDP---------GQLFPMVLLVFLL
O70337_BIK-01           -----LTPGAW----------VSPDQDP---------GQLFPMVLLVFLL
O70337_BIK-02           -----LTPGAW----------VSPDQDP---------GQLFPMVLLVFLL
Q925D2_BIK-01           -----FTPGAW----------VSPDQDP---------GQLFPMVLLVFLL
G1TZR9_BIK-01           ----GRGAAAP----------AAVRPLP---------GQGWPPSWRVVLL
H0W025_BIK-01           ----RPASRAW----------VSPRWTC---------RWLLPVLLLLLLL
A0A2K5CLG5_BIK-01       -----LSSGSW----------VSRKQAV---------L--LALLALLLAM
F7FUT7_BIK-01           -----LSSGSW----------VSRKQAV---------L--LALLALLLAM
A0A2K6TBD7_BIK-01       -----LSSGSW----------VSGKQAV---------L--LALLALLLAM
H2P4N6_BIK-01           -----L--------------------------------------------
G1S1X2_BIK-01           -----PNPGSR----------VSREQML---------LVLLVLLLLLLPL
G3QCT2_BIK-01           -----PNPGSW----------VSREQVL---------LALLLLLALLLPL
A0A2R8ZXD2_BIK-01       -----PNPRSW----------VSREQVL---------LALLLLLALLLPL
H2QLU7_BIK-01           -----PNPGSW----------VSREQVL---------LALLLLLALLLPL
Q13323_BIK-01           -----PNPGSW----------VSCEQVL---------LALLLLLALLLPL
A0A2K6MCW0_BIK-01       -----LNPGSQ----------VSREQVL---------LALLLLLA---AL
A0A2K6QK74_BIK-01       -----LNPGSQ----------VSREQVL---------LALLLLLA---AL
A0A0D9QZY8_BIK-01       -----LNPGSW----------VSREQVL---------LALL-LLALLLAL
A0A2K5VW94_BIK-01       -----PNPRSW----------VSREQVL---------LVLLLLLALLLAL
A0A2K6DBJ4_BIK-01       -----PNPRSW----------VSREQVL---------LVLLLLLALLLAL
A0A2K5J4Q7_BIK-01       -----PNPGSR----------VSREQVL---------LALLLLLALLLAL
A0A096NKG5_BIK-01       -----PNPRSW----------VSREQVL---------LALLLLLALLLAL
A0A2K5LDM6_BIK-01       -----PNPRSW----------VSHEQVL---------L----LLALLLAL
A0A2K5XSA1_BIK-01       -----PNPRSW----------VSREQVL---------L----LLALLLAL
F1PUF4_BIK-01           -----LTFRNR----------VSPNPGR---------GLVLSLLLLLVLL
H0XAE7_BIK-01           -----LSRGPW----------VCPAPAW---------EQVLLLLLLLVLL
A0A2K6FM79_BIK-01       -----LSPRPW----------VCPAPAW---------EQVLLLLLVL-LL
A0A3P8XIA2_BCL2L11      -------PGDMR-PEILIGQELQRIGDE---------FNN-LFIHGVSGC
F7G1G0_HRK-01           ----------------WAWLCAAAHVAA---------LAAWLLRRRNL--
P62816_HRK-03           -------------RARWPWLCAAAQVAA---------LAAWLLGRRSA--
P62817_HRK-01           -------------RARWPWLCAAAQVAA---------LAAWLLGRRSA--
A0A287A5N9_HRK-01       ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
H2NIS8_HRK-01           ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
A0A2K5KZ69_HRK-01       ----------------WPWLCAAAQVAA---------LAAWLLSRRNL--
H2Q6Y8_HRK-01           ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
G3UH24_HRK-01           ----------------WPWLCAAAQVAA---------LAAWLLRRRNL--
A0A2K5BYA0_HRK-01       ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
U3E722_HRK-01           ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
A0A452DXE5_HRK-01       ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
A0A0D9SC73_HRK-01       ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
A0A3Q2IBL3_HRK-01       ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
A0A337SQ56_HRK-01       ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
G3QTJ6_HRK-01           ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
O00198_HRK-01           ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
A0A1D5R1E4_HRK-01       ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
A0A2K6AYL7_HRK-01       ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
G1QHD8_HRK-01           ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
G1T7W1_HRK-01           ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
H0Y001_HRK-01           ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
A0A096N944_HRK-01       ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
A0A2K6GL98_HRK-01       ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
E2RLD4_HRK-01           ----------------WPWLCAAAQVAA---------LAAWLLGRRNL--
F7GVS7_BAD-04           ----DPSPTPSC-PFLAP--------------------------------
Q2PG01_BAD-01           ----SSAPSQ----------------------------------------
A0A2I3H4B2_BAD-01       ----SSAPSQ----------------------------------------
A0A452IFQ4_BAD-01       ----DALPRSSK--------------------------------------
K7GA86_BCL2L11-01       ----PSIREDMQ-PEIWIAQELRRIGDE---------FNASYCPRRGFLD
A0A3Q2GRS5_BCL2L11      ----QAVPADMR-PEVWIAQELRRIGDE---------FNA-SYPRRVVLN
Q4KMV9_BCL2L11-01       -------PVNQMSPELWIAQELRRIGDD---------FNASFSPRRGIFN
F7FTC8_BCL2L11-01       ----QSVPEDMR-PEIWIAQELRRIGDE---------FNASYCPRRGLLD
A0A2K6E226_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
O43521_BCL2L11-11       ----VLLPQPPK--------------------------------------
F7HHA9_BCL2L11-08       ----VLLPQPPK--------------------------------------
O54918_BCL2L11-06       ----QEEPEDLR-PEIRIAQELRRIGDE---------FNE-TYTRRVFAN
O54918_BCL2L11-08       ----QEEPEDLR-PEIRIAQELRRIGDE---------FNE-TYTRRVFAN
O54918_BCL2L11-03       ----NQVAQNIH-GDAWYN-------------------------------
A0A2I3HW02_BCL2L11      ----SL-------EVQWPFEWLAKSS------------------------
A0A2K6TRZ5_BCL2L11      ----SL--ALRR-EVQCPLEWLAKSS------------------------
A0A2K5HZI7_BCL2L11      ----SLRIALHR-EVQ----------------------------------
A0A2K5NU92_BCL2L11      ----SLRIALHR-EVQWPLECLASS-------------------------
A0A2K5Z8B6_BCL2L11      ----SLGIALHR-EVQWPLECLASS-------------------------
A0A2I2YQ13_BCL2L11      ----SLRIALHR-EVQWPLEWLAKSS------------------------
O43521_BCL2L11-15       ----SLRIALHR-EVQWPLKWLAKSS------------------------
A0A2R9CA99_BCL2L11      ----SLRIALHR-EVQWPLKWLAKSS------------------------
A0A2J8JCT2_BCL2L11      ----SLRIALHR-EVQWPLKWLAKSS------------------------
F7HHA9_BCL2L11-07       ----SLGIALHR-EVQWPLEWLA---------------------------
A0A2K5CAB2_BCL2L11      ----SLGIALRR-EVQWPLEWLAKSS------------------------
A0A2K5X2I7_BCL2L11      ----SLGIALHR-EVQWPLEWLASS-------------------------
A0A2I3M6I1_BCL2L11      ----SLGIALHR-EVQWPLEWLASS-------------------------
O43521_BCL2L11-07       ----EIEEVVV---------------------------------------
O43521_BCL2L11-22       ----EIEEVVV---------------------------------------
A0A452U4S4_BCL2L11      ----RHLETAL---------------------------------------
C1KGB8_BCL2L11-01       ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRVMLF
A0A2K6GE31_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRLAKC
A0A337SW42_BCL2L11      ----QAVPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRLARV
O43521_BCL2L11-17       ----E--PADMR-PEIWIAQELRRIGDE---------FNA-YYARRMPLP
O43521_BCL2L11-10       ----E--PADMR-PEIWIAQELRRIGDE---------FNA-YYARRMPLP
A0A2I2YQ13_BCL2L11      ----E--PADMR-PEIWIAQELRRIGDE---------FNA-YYARRLAKL
O43521_BCL2L11-19       ----E--PADMR-PEIWIAQELRRIGDE---------FNA-YYARRLAKL
O43521_BCL2L11-13       ----E--PADMR-PEIWIAQELRRIGDE---------FNA-YYARRLAKL
A0A2I3HW02_BCL2L11      ----E--PADMR-PEIWIAQELRRIGDE---------FNA-YYARRLAKL
A0A2R9CA99_BCL2L11      ----E--PADMR-PEIWIAQELRRIGDE---------FNA-YYARRLAKL
A0A2J8JCT2_BCL2L11      ----E--PADMR-PEIWIAQELRRIGDE---------FNA-YYARRLAKL
A0A2K5NU92_BCL2L11      ----E--PADMR-PEIRIAQELRRIGDE---------FNA-YYARRLAEL
A0A2K5X2I7_BCL2L11      ----E--PADMR-PEIRIAQELRRIGDE---------FNA-YYARRLAEL
F7HHA9_BCL2L11-05       ----E--PADMR-PEIRIAQELRRIGDE---------FNA-YYARRLAEL
A0A2K5Z8B6_BCL2L11      ----E--PADMR-PEIRIAQELRRIGDE---------FNA-YYARRLAEL
A0A2K5HZI7_BCL2L11      ----E--PADMR-PEIRIAQELRRIGDE---------FNA-YYARRLAKL
A0A2K6KJP8_BCL2L11      ----E--PADMR-PEIRIAQELRRIGDE---------FNA-YYARRLAKL
A0A2K6QIL2_BCL2L11      ----E--PADMR-PEIRIAQELRRIGDE---------FNA-YYARRLAKL
O54918_BCL2L11-05       ----QEEPEDLR-PEIRIAQELRRIGDE---------FNE-TYTRRVFAN
O88498_BCL2L11-02       ----QEEPEDLR-PEIRIAQELRRIGDE---------FNE-TYTRRAFAN
A0A0D9RWE0_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRL---
O43521_BCL2L11-05       ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRL---
O43521_BCL2L11-25       ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRL---
F1SU81_BCL2L11-03       ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRVMLF
A0A2K6GE31_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
A0A286XJN2_BCL2L11      ----QAGPPHLR-PEIWIAQELRRIGDE---------FNA-SYPRRVFLN
A0A2K5CAB2_BCL2L11      ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
A0A2K6TRZ5_BCL2L11      ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
A0A2K6QIL2_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K5NU92_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K5HZI7_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K5X2I7_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K6E226_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K5Z8B6_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2I3M6I1_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2I3M6I1_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K6KJP8_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2I2YQ13_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRVFLN
O43521_BCL2L11-02       ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRVFLN
A0A2R9CA99_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRVFLN
A0A2J8JCT2_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRVFLN
H2P5E2_BCL2L11-01       ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRVFLN
A0A337SW42_BCL2L11      ----QAVPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
A0A452SBG5_BCL2L11      ----QDVPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
Q2YDF0_BCL2L11-01       ----QAVPADTR-PEIWIAQELRRIGDE---------FNA-YYPRRVFVR
A0A287DFJ0_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNL-YYPRRVFFN
Q2YDF0_BCL2L11-03       ----QAVPADTR-PEIWIAQELRRIGDE---------FNA-YYPRRVFVR
A0A452FCS1_BCL2L11      ----QAVPADTR-PEIWIAQELRRIGDE---------FNA-YYPRRVFVR
A0A2K5CAB2_BCL2L11      -----GDISLWF-RFIFTFFDL--------------------YG-----H
A0A2K5Z8B6_BCL2L11      ----IGDSSL-F-GFIFTGLDL--------------------YG-----H
A0A2K6KJP8_BCL2L11      ----IGDTSLWF-GFIFTGLDL--------------------YVVWIYIY
A0A2K6QIL2_BCL2L11      ----IGDTSLWF-GFIFTGLDL--------------------YVVWIYIY
F6XMC1_BCL2L11-09       ----IGDISLWF-RFTFTFFDL--------------------CG-----H
A0A2K6TRZ5_BCL2L11      ----IGDISLWF-RFIFTFFDL--------------------YG-----Y
A0A2K5HZI7_BCL2L11      ----IGDTSLWF-GFIFTGLDL--------------------YG-----H
A0A2R9CA99_BCL2L11      ----IGDLSLCF-GFIFTGLDL--------------------YG-----H
A0A2J8JCT2_BCL2L11      ----IGDLSLCF-GFIFTGLDL--------------------YG-----H
A0A2K5NU92_BCL2L11      ----IGDSSLWF-GFIFTGLDL--------------------YG-----H
A0A2K5X2I7_BCL2L11      ----IGDSSLWF-GFIFTGLDL--------------------YG-----H
F7HHA9_BCL2L11-09       ----IGDSSLWF-GFIFTGLDL--------------------YG-----H
A0A2K6E226_BCL2L11      ----IGDSSLWF-GFIFTGLDL--------------------YG-----H
A0A2I3M6I1_BCL2L11      ----IGDSSLWF-GFIFTGLDL--------------------YG-----H
A0A2I2YQ13_BCL2L11      ----IGDLSLWF-GFIFTGLDL--------------------YG-----H
O43521_BCL2L11-06       ----IGDLSLCF-GFIFTGLDL--------------------YG-----H
O43521_BCL2L11-23       ----IGDLSLCF-GFIFTGLDL--------------------YG-----H
A0A2I3HW02_BCL2L11      ----VGDISLWF-GFIFTGLDL--------------------YG-----H
M3YDI3_BCL2L11-01       ----QAVPADMR-PEMWIAQELRRIGDE---------FNA-YYPRRVFLN
F6XMC1_BCL2L11-02       ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRVNWI
F6XMC1_BCL2L11-01       ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRVNWI
F7CXT2_BCL2L11-01       ----QSIPADMR-PEIWIAQELRRIGDE---------FNASYYPRRGFLD
O54918_BCL2L11-01       ----QEEPEDLR-PEIRIAQELRRIGDE---------FNE-TYTRRVFAN
O88498_BCL2L11-01       ----QEEPEDLR-PEIRIAQELRRIGDE---------FNE-TYTRRAFAN
A0A337SW42_BCL2L11      ---------------GLFE-------------------------------
A0A337SW42_BCL2L11      -------------EEGVL--------------------------------
A0A2K5NU92_BCL2L11      -------------EEVVV--------------------------------
A0A2K5HZI7_BCL2L11      -------------EEVVV--------------------------------
A0A2I2YQ13_BCL2L11      -------------EEVVV--------------------------------
O43521_BCL2L11-24       -------------EEVVV--------------------------------
O43521_BCL2L11-08       -------------EEVVV--------------------------------
A0A2K5X2I7_BCL2L11      -------------EEVVV--------------------------------
F7HHA9_BCL2L11-03       -------------EEVVV--------------------------------
A0A2K6E226_BCL2L11      -------------EEVVV--------------------------------
A0A2K5Z8B6_BCL2L11      -------------EEVVV--------------------------------
A0A2I3HW02_BCL2L11      -------------EEVVV--------------------------------
A0A2R9CA99_BCL2L11      -------------EEVVV--------------------------------
A0A2J8JCT2_BCL2L11      -------------EEVVV--------------------------------
A0A2I3M6I1_BCL2L11      -------------EEVVV--------------------------------
A0A2K6KJP8_BCL2L11      -------------EEVVV--------------------------------
A0A2K6QIL2_BCL2L11      -------------EEVVV--------------------------------
A0A2K5CAB2_BCL2L11      -------------EEVVV--------------------------------
F6XMC1_BCL2L11-06       -------------EEVVV--------------------------------
A0A2K6TRZ5_BCL2L11      -------------EEVVV--------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      -------------EEVVV--------------------------------
A0A2K6GE31_BCL2L11      --------------GIFE--------------------------------
F6XMC1_BCL2L11-08       ----QQPCLPWKVRGIGEKQEERVNPHT---------WET-FKSTRTHSL
A0A2K6GE31_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
A0A2K6GE31_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRMPLP
A0A287DFJ0_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNL-YYPRRVFFN
A0A286XJN2_BCL2L11      ----QAGPPHLR-PEIWIAQELRRIGDE---------FNA-SYPRRVFLN
A0A286XJN2_BCL2L11      ----QAGPPHLR-PEIWIAQELRRIGDE---------FNA-SYPRRVFLN
A0A2K5CAB2_BCL2L11      ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRLEK-
F6XMC1_BCL2L11-07       ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRLEK-
A0A2K6TRZ5_BCL2L11      ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRLEK-
F6XMC1_BCL2L11-05       ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRISLL
A0A2K6TRZ5_BCL2L11      ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRISLP
A0A2K5CAB2_BCL2L11      ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRISLP
A0A2K5NU92_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRMSLP
A0A2K5HZI7_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRMSLP
A0A2K5X2I7_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRMSLP
F7HHA9_BCL2L11-02       ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRMSLP
A0A2K6E226_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRMSLP
A0A2K5Z8B6_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRMSLP
A0A2I3M6I1_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRMSLP
A0A2K6KJP8_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRMSLP
A0A2K6QIL2_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRMSLP
A0A2I2YQ13_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRMPLP
O43521_BCL2L11-09       ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRMPLP
O43521_BCL2L11-21       ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRMPLP
A0A2R9CA99_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRMPLP
A0A2J8JCT2_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRMPLP
A0A2K5NU92_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRLEK-
A0A2K5HZI7_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRLEK-
A0A2K5X2I7_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRLEK-
F7HHA9_BCL2L11-04       ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRLEK-
A0A2K6E226_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRLEK-
A0A2K5Z8B6_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRLEK-
A0A2I3M6I1_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRLEK-
A0A2K6KJP8_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRLEK-
A0A2K6QIL2_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRLEK-
A0A2I2YQ13_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRLEK-
O43521_BCL2L11-20       ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRLEK-
A0A2I3HW02_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRLEK-
A0A2R9CA99_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRLEK-
A0A2J8JCT2_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRLEK-
A0A2K5CAB2_BCL2L11      ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
A0A2K5CAB2_BCL2L11      ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
F6XMC1_BCL2L11-03       ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
A0A2K6TRZ5_BCL2L11      ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
A0A2K6TRZ5_BCL2L11      ----QAEPAGMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
A0A2K6QIL2_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K6QIL2_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K5NU92_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K5HZI7_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K5X2I7_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K6E226_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K6E226_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K5Z8B6_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2I3M6I1_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K6KJP8_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2K6KJP8_BCL2L11      ----QAEPADMR-PEIRIAQELRRIGDE---------FNA-YYARRVFLN
A0A2I2YQ13_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRVFLN
O43521_BCL2L11-03       ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRVFLN
A0A2I3HW02_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRVFLN
A0A2R9CA99_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRVFLN
A0A2J8JCT2_BCL2L11      ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYARRVFLN
A0A337SW42_BCL2L11      ----QAVPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRLEQ-
A0A452FCS1_BCL2L11      ----QAVPADTR-PEIWIAQELRRIGDE---------FNA-YYPRRVFV-
W5PY58_BCL2L11-01       ----QAVPADTR-PEIWIAQELRRIGDE---------FNA-YYPRRVFV-
Q2YDF0_BCL2L11-02       ----QAVPADTR-PEIWIAQELRRIGDE---------FNA-YYPRRVFV-
F1SU81_BCL2L11-02       ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRVMLF
G1SSY0_BCL2L11-01       ----QAEPADTR-PETWIAQELRRIGDE---------FNA-YYPRRVFLN
H0XW23_BCL2L11-01       ----QAEPADLR-PEMWIAQELRRIGDE---------FNA-YYPTRVFLH
A0A337SW42_BCL2L11      ----QAVPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
G1LDR8_BCL2L11-01       ----QAVPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
J9NWV6_BCL2L11-01       ----QAVPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
F1SU81_BCL2L11-01       ----QAEPADMR-PEIWIAQELRRIGDE---------FNA-YYPRRVFLN
                                                                          

A0A287AZR7_PMAIP1-      -----------AIRQQITNFIIFFFFLGP---------------------
G1MV54_BCL2L11-01       DNH---AGNPQVVILRLLHYIIRLIWRMQ---------------------
G1PDJ5_BCL2L11-01       NVYREAEGHPQMVVLRLLRYILRLVWRRM---------------------
A0A452J430_PMAIP1-      -------------QQKILNVITKLFCPGT---------------------
A0A1D5PAR2_PMAIP1-      -------------QQKVLNLITKLFCPKT---------------------
A0A2K6EM90_PMAIP1-      -------------QQKLLNLIAKLFRSGT---------------------
G1P8F9_PMAIP1-01        -------------LQKLLNLMYKLFGSGT---------------------
Q9JM54_PMAIP1-03        -------------RQKLLNLISKLFNLVT---------------------
A0A3Q2I0H2_PMAIP1-      -------------RQKLLNLIAKLFRSGT---------------------
G3T0P7_PMAIP1-01        -------------RQKLLNVICKLFCSGT---------------------
Q1PCT2_PMAIP1-01        -------------RQKLLNLLSKLFRSGT---------------------
G1LIZ7_PMAIP1-01        -------------RQKLLNLISKLFRSGT---------------------
A0A452STA4_PMAIP1-      -------------RQKLLNLISKLFRSGT---------------------
A0A2K5NJZ2_PMAIP1-      -------------RQKLLNLIAKLFCSGT---------------------
A0A0D9S003_PMAIP1-      -------------RQKLLNLIAKLFCSGT---------------------
A0A2K5VPX2_PMAIP1-      -------------RQKLLNLIAKLFCSGT---------------------
A0A2K6BV75_PMAIP1-      -------------RQKLLNLIAKLFCSGT---------------------
A0A2K5ZWH1_PMAIP1-      -------------RQKLLNLIAKLFCSGT---------------------
A0A096MPU8_PMAIP1-      -------------RQKLLNLIAKLFCSGT---------------------
A0A2K5JY52_PMAIP1-      -------------RQKLLNLIAKLFCSGT---------------------
A0A2K6KJF2_PMAIP1-      -------------RQKLLNLIAKLFCSGT---------------------
A0A2K6NC45_PMAIP1-      -------------RQKLLNLIAKLFCSGT---------------------
A0A2K6S6C4_PMAIP1-      -------------RQKLLNLISKLFCSGT---------------------
A0A2I2YVQ5_PMAIP1-      -------------RQKLLNLISKLFCSGT---------------------
Q13794_PMAIP1-01        -------------RQKLLNLISKLFCSGT---------------------
A0A2R9AKC9_PMAIP1-      -------------RQKLLNLISKLFCSGT---------------------
A0A2I3SX38_PMAIP1-      -------------RQKLLNLISKLFCSGT---------------------
H2NWG2_PMAIP1-01        -------------RQKLLNLISKLFCSGT---------------------
A0A2K5CFK7_PMAIP1-      -------------RQKLLNLISKLFCSGT---------------------
F7GW45_PMAIP1-01        -------------RQKLLNLISKLFCSGT---------------------
A0A337SUX1_PMAIP1-      -------------RQKLMNLISKLFRSGT---------------------
A0A3Q1NFP6_PMAIP1-      -------------RQKLVNLISKLLRSGT---------------------
A0A452EST2_PMAIP1-      -------------RQKLVNLIAKLLRSGT---------------------
W5P738_PMAIP1-01        -------------RQKLVNLIAKLLRSGT---------------------
Q9JM54_PMAIP1-02        -------------RQKLLNLISKLFNLVT---------------------
A0A2I3HX97_PMAIP1-      -------------RQKLLNLISKLFCSGT---------------------
A0A452TE71_PMAIP1-      -------------RQKLLNLISKLFRSGT---------------------
A0A0P0HZF9_PMAIP1-      -------------KYKLLEIIIALQKAQTDGKR-----------------
Q0GKC8_PMAIP1-01        -------------KYKLLELIVTLQKIQMEGKR-----------------
Q6JTU4_BCL2L11-01       -------------ARRLEK-------------------------------
A0A3B5RFA9_PMAIP1-      -------------RYKLLEMLLKNYETLNKIK------------------
K7E5Y2_BBC3-01          QRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN-----------------
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2K5F6X4_BBC3-02      ---------------------QPQHRPSPW---------------R----
A0A337SQV0_BBC3-03      ---------------------QQRHRPSPW---------------R----
A0A3P8RLE2_BCL2L11      SCTFNLCNSFCTLFSVTVFCHLQSLFASTL---------------Q----
A0A3B1JLM2_BAD-01       TG-------------------PGRHTNRGW---------------F----
A0A3Q2LHE3_BIK-02       MDGL-----------------TNLRENIRF---------------WSFLT
E7FBJ6_BAD-01           --T----------------PNSQKQTYRGW---------------F----
B5XEF1_BAD-01           IIP----------------RGGKQKVSRGW---------------F----
H3D8J8_BAD-01           SSAG---------------SARQMHHSRSW---------------W----
A0A3B5L9R9_BAD-01       SSDG---------------SNRPIHHSRSW---------------W----
Q9GL49_PMAIP1-01        QTNPTRVALPPDPEVECAIQFRRIGDKLNFRQK------------L----
A0A3B1IH05_BAD-01       RSAG---------------AARQMQNSPSW---------------F----
A0A3Q2QC80_BAD-01       SSAG---------------TNRPIHHSRSW---------------W----
A0A3Q3MLA0_BAD-02       GGGGSRGGCGLVVESVVSQPKSQEFNTQLLQPHVRCVLGSLNVYKW----
A0A3Q3MLA0_BAD-03       RSPG---------------PAKQMHHSKSW---------------W----
I3K7B6_BAD-01           --------------------LKKLHHSKTW---------------W----
A0A3P9B2E4_BAD-01       --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------VKKLHHSKTW---------------W----
A0A3P8QRJ7_BAD-01       --------------------VKKLHHSKTW---------------W----
A0A3Q4GGN3_BAD-01       --------------------LKKLHHSKTW---------------W----
A0A3B4GXJ6_BAD-01       --------------------VKKLHHSKTW---------------W----
A0A3Q2D5S0_BAD-01       SSTG---------------TNRPIRHSKSW---------------W----
A0A3B3BQF7_BAD-01       RSAG---------------ATKQMHHSTSW---------------W----
A0A3Q1K1C7_BAD-02       RSAG---------------TARQMHHSKSW---------------W----
A0A3Q1K1C7_BAD-01       RSAG---------------TARQMHHSKSW---------------W----
A0A3Q1GWH9_BAD-01       RSAG---------------TARQMHHSKSW---------------W----
A0A3Q1CPU7_BAD-01       RSAG---------------TARQMHHSKSW---------------W----
A0A3P8TWH6_BAD-01       RSAG---------------TARQMHHSKSW---------------W----
A0A2U9BAC9_BAD-01       KSAG---------------TARQMHHSQSW---------------W----
A0A3B4VFC5_BAD-01       KSAG---------------TAKQMHHSKSW---------------W----
A0A3B4W9T1_BAD-01       KSAG---------------TAKQMHHSKSW---------------W----
A0A3Q0QNQ2_BAD-01       KNAG---------------TTRKMHHSKTW---------------W----
A0A3P8WIZ8_BAD-02       KSAG---------------TARQMHHSKSW---------------W----
A0A3P8WIZ8_BAD-01       KSAG---------------TARQMHHSKSW---------------W----
A0A3P9A5G8_BAD-02       IIPG---------------RAKQ-VY-RGW---------------F----
A0A3P9A5G8_BAD-01       IIPG---------------RAKQ-VY-RGW---------------F----
B5X1T1_BAD-01           ISPG---------------GVKQEVS-RGW---------------F----
H3ANP3_BAD-03           KSAG---------------AAGEMVD-ESW---------------W----
H3ANP3_BAD-04           KSAG---------------AAGEMVD-ESW---------------W----
H3ANP3_BAD-02           KSAG---------------AAGEMVD-ESW---------------W----
H3ANP3_BAD-01           KSAG---------------AAGEMVD-ESW---------------W----
A0A3B3QX41_BAD-01       RSAG---------------AARQMQASPSW---------------F----
Q4V925_BAD-02           KSAG---------------TARQMSQSPSW---------------L----
Q4V925_BAD-03           KSAG---------------TARQMSQSPSW---------------L----
A7MCM4_BAD-01           KSAG---------------TARQMSQSPSW---------------L----
Q4V925_BAD-04           KSAG---------------TARQMSQSPSW---------------L----
Q4V925_BAD-01           KSAG---------------TARQMSQSPSW---------------L----
A0A3P8Y761_BAD-01       KSAG---------------AAKQMTTSPSW---------------W----
A0A3B5K831_BAD-01       NSTG---------------STKPMHHSRSW---------------W----
A0A3B5Q2N7_BAD-01       SSDG---------------SNRPIHHSRSW---------------W----
A0A087X8P8_BAD-01       SSTG---------------SNRPIHHSRSW---------------W----
A0A3B3UA11_BAD-01       SSTG---------------SNRPIHHSRSW---------------W----
A0A3B3YFR1_BAD-01       SSTG---------------SNRPIHHSRSW---------------W----
A0A3P9Q7C3_BAD-01       SSAG---------------SNGPIHHSRSW---------------W----
A0A3B3HDU2_BAD-01       RSTG---------------AAKQMLHSTSW---------------W----
A0A3B5BAL2_BAD-01       RSAG---------------TAKQMHHSKSW---------------W----
A0A3Q3AEL8_BAD-02       KSAG---------------TTKQIHHSRSW---------------W----
A0A3Q3AEL8_BAD-01       KSAG---------------TTKQIHHSRSW---------------W----
G3Q8B3_BAD-01           KSAG---------------TTKQMQHSKSW---------------W----
A0A3Q2Y0E4_BAD-01       SAGG---------------TSRAIHHSKTW---------------W----
A0A3Q3R5S3_BAD-01       RSAG---------------AASQMHHSKSW---------------W----
A0A3Q3RXS8_BAD-02       RNAG---------------KAQKMHHSKTW---------------W----
A0A3Q3RXS8_BAD-01       RNAG---------------KAQKMHHSKTW---------------W----
A0A3Q0QNQ2_BAD-02       KNAG---------------TTRKMHHSKTW---------------W----
A0A3Q3WTY4_BAD-01       RSAG---------------TATQMHQSRSW---------------W----
A0A3B1JXK6_BCL2L11      GGGAQ----------------LPAQNEPAF---------------I----
A0A3B4BVX1_BCL2L11      GCVAG----------------MQALSNPVA---------------F----
A0A3B4BVX1_BCL2L11      HGVSQLHGCVA----------GMQ--------------------------
A0A3B4BVX1_BCL2L11      HGAGRNGGRVQ----------LPAEEEPAF---------------M----
A0A3P8XIA2_BCL2L11      NGQ--VAQANL----------PQMHQEPAF---------------L----
A0A3Q1ICY2_BCL2L11      HRWVGIQPIRL----------PHIHQDPTV---------------L----
A0A3Q3K6I5_BCL2L11      RRRV------V----------PRIHQELTI---------------V----
A0A3B4V919_BCL2L11      QCCQTH--------------------------------------------
A0A3B4XZH1_BCL2L11      WCVCVC--------------------------------------------
A0A3Q3ESW6_BCL2L11      HGRPEVHPNPQ----------PHIQPEPTM---------------L----
A0A3Q2SZH6_BCL2L11      QQRDMVPLNLM----------PHIQQEPVA---------------M----
A0A3B3VNE0_BCL2L11      HQRNIVPLNLM----------PHIQQEPVA---------------M----
A0A3B3YII5_BCL2L11      HQRNIVPLNLM----------PHIQQEPVA---------------M----
A0A3B3YII5_BCL2L11      HQRNIVPLNLM----------PHIQQEPVA---------------M----
A0A3P9N073_BCL2L11      ----VLPVQLM----------IQQFSHATS---------------IGIKK
A0A3Q3B113_BCL2L11      PRRNIVPLNLL----------PHIHQEPVA---------------M----
A0A3B5M375_BCL2L11      -----IAVNIG----------PVLFIRPIP---------------M----
A0A3B5QAM1_BCL2L11      HQRNIVPLNLM----------PHIQQEPVA---------------M----
A0A3B5QAM1_BCL2L11      HQRNIVPLNLM----------PHIQQEPVA---------------M----
A0A2I3HWI8_BBC3-03      ---------------------QQRHRPSPW---------------R----
A0A2K6FQZ3_BBC3-04      ---------------------QQRHRPSPW---------------R----
Q9BXH1_BBC3-05          ---------------------QQRHRPSPW---------------R----
A0A2R9BZA9_BBC3-01      ---------------------QQRHRPSPW---------------R----
A0A2I3RGH5_BBC3-03      ---------------------QQRHRPSPW---------------R----
A0A2K5P2T8_BBC3-03      ---------------------QQRHRPSPW---------------R----
A0A2K5V8J3_BBC3-03      ---------------------QQRHRPSPW---------------R----
F7FFP6_BBC3-03          ---------------------QQRHRPSPW---------------R----
A0A2K6ASP2_BBC3-03      ---------------------QQRHRPSPW---------------R----
A0A2I3N2Z9_BBC3-03      ---------------------QQRHRPSPW---------------R----
A0A2K6QZU4_BBC3-04      ---------------------QQRHRPSPW---------------R----
A0A2R8MW85_BBC3-03      ---------------------QPQHRPSPW---------------R----
A0A2K6STD6_BBC3-02      ---------------------QPQHRPSPW---------------R----
G3T2N1_BBC3-01          ---------------------QHRHRPSPW---------------R----
M3Y0R3_BBC3-01          ---------------------QQRHRPSPW---------------R----
Q99ML1_BBC3-02          ---------------------QHRHRPSPW---------------R----
Q80ZG6_BBC3-01          ---------------------QHRHRPSPW---------------R----
H0XQ00_BBC3-01          ---------------------QQRHRPSPW---------------R----
A0A3Q2GWE8_BBC3-01      ---------------------QQRHRPSPW---------------R----
A0A3Q1LXZ6_BBC3-01      ---------------------RQRHRPSPW---------------R----
A0A452E3G1_BBC3-01      ---------------------RQRHRPSPW---------------R----
J9NTK9_BBC3-01          ---------------------QQRHRPSPW---------------R----
A0A337SQV0_BBC3-02      ---------------------QQRHRPSPW---------------R----
F1RM01_BBC3-01          ---------------------QQRHRPSPW---------------R----
A0A2K6FQZ3_BBC3-01      ---------------------QQRHRPSPW---------------R----
Q9BXH1_BBC3-06          ---------------------QQRHRPSPW---------------R----
A0A2I3RGH5_BBC3-01      ---------------------QQRHRPSPW---------------R----
H2NZD3_BBC3-01          ---------------------QQRHRPSPW---------------R----
A0A2K6QZU4_BBC3-01      ---------------------QQRHRPSPW---------------R----
A0A0D9S2H2_BBC3-01      ---------------------QQRHRPSPW---------------R----
B4DQK3_BBC3-01          ---------------------QQRHRPSPW---------------R----
A0A3Q3MLA0_BAD-01       GGGGSRGGCGLVVES----VVSQPKSQEFN---------------T----
G1SS60_BAD-01           SAGTA----------------MQMRESSSW---------------T----
K7E5Y2_BBC3-02          RRREE----------------EQRRHLSPW---------------R----
A0A3B4DUY7_BAD-01       ------------------------RASSPG---------------K----
A0A337SAW2_BAD-01       SAGTA----------------TQMRQSPSW---------------T----
A0A2I3TBK7_BAD-01       ALGSH----------------LEYGRKYFP---------------Q----
A0A2R8Z697_BAD-02       ALGSH----------------LEYGRKYFP---------------Q----
A0A2I2Z8C7_BAD-03       ALGSH----------------LEYGRKYFP---------------Q----
Q92934_BAD-03           ALGSH----------------LEYGRKYFP---------------Q----
A0A2K5M0C1_BAD-02       VLVGH----------------LGYGRKCFP---------------Q----
A0A2K5XJR2_BAD-02       VLVGH----------------LGYGRKCFP---------------Q----
A0A2I3MCN5_BAD-03       VLVGH----------------LGYGRKCFP---------------Q----
A0A2K5VCD8_BAD-02       VLVGH----------------LGYGRKCFP---------------Q----
F7GVS7_BAD-02           VLVGH----------------LGYGRKCFP---------------Q----
A0A2K6E7J3_BAD-02       VLVGH----------------LGYGRKCFP---------------Q----
A0A2K5E6K7_BAD-02       ALGGH----------------LGYGRKCFL---------------Q----
A0A2K6TG62_BAD-02       ALGGH----------------LGHGRKCFL---------------Q----
A0A2K5E6K7_BAD-03       GRRRT----------------KGWRRSPAP---------------F----
A0A2K5HKW9_BAD-02       GRRRT----------------KGWRRSPAP---------------F----
A0A2K6N1A1_BAD-02       GRRRT----------------KGWRRSPAP---------------F----
A0A2K6PUM5_BAD-02       GRRRT----------------KGWRRSPAP---------------F----
A0A2K5M0C1_BAD-03       GRRRT----------------KGWRRSPAP---------------F----
A0A2K5VCD8_BAD-03       GRRRT----------------KGWRRSPAP---------------F----
F7GVS7_BAD-03           GRRRT----------------KGWRRSPAP---------------F----
A0A2K5XJR2_BAD-03       GRRRT----------------KGWRRSPAP---------------F----
A0A2I3MCN5_BAD-02       GRRRT----------------KGWRRSPAP---------------F----
A0A2K6E7J3_BAD-03       GRRRT----------------KGWRRSPAP---------------F----
A0A2I2Z8C7_BAD-04       GRRTT----------------KGWGRSPAP---------------F----
Q92934_BAD-04           GRRTT----------------KGWGRSPAP---------------F----
A0A2I3TBK7_BAD-03       GRRTT----------------KGWGRSPAP---------------F----
A0A2R8Z697_BAD-03       GRRTT----------------KGWGRSPAP---------------F----
F6SJL0_BAD-02           GRRRT----------------KGWRRSPAP---------------F----
A0A2K6TG62_BAD-03       GRRGT----------------KGWRRSPAL---------------F----
G3VRY4_BAD-02           SAGTA----------------SQMRRSHGW---------------T----
G3VRY4_BAD-01           SAGTA----------------SQMRRSHGW---------------T----
G1P8C5_BAD-01           SAGTA----------------TQMWQKSSW---------------T----
A0A452ER54_BAD-02       SAGTA----------------TQMRQSPSW---------------T----
W5P8G9_BAD-01           SAGTA----------------TQMRQSPSW---------------T----
G3TP47_BAD-01           SAGTA----------------TQMRQSPSW---------------T----
G1MI17_BAD-01           SAGTA----------------TQMRQSPSW---------------T----
A0A287AEF3_BAD-01       SAGTA----------------TQMRQSPSW---------------K----
M3YNE7_BAD-01           SAGTA----------------TQMRQSPSW---------------T----
A0A452RJM6_BAD-01       SAGTA----------------TQMRQSPSW---------------T----
A0A384DJL2_BAD-01       SAGTA----------------TQMRQSPSW---------------T----
A0A452ER54_BAD-01       SAGTA----------------TQMRQSPSW---------------T----
F1MUT9_BAD-01           SAGTA----------------TQMRQSPSW---------------T----
Q3SYZ0_BAD-01           SAGTA----------------TEMRQSPSW---------------T----
F7DN67_BAD-01           SAGTA----------------TQMRQSPSW---------------T----
O35147_BAD-01           SAGTA----------------TQMRQSASW---------------T----
H0WVR2_BAD-01           SAGTA----------------TQMRQSSSW---------------T----
H0V608_BAD-01           SAGTA----------------TKLWQNSNW---------------T----
A0A2K5E6K7_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
A0A2K6TG62_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
A0A0D9R491_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
A0A2K5M0C1_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
A0A2K5VCD8_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
F7GVS7_BAD-01           SAGTA----------------TQMRQSSSW---------------T----
A0A2K6E7J3_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
A0A2K5XJR2_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
A0A2I3MCN5_BAD-04       SAGTA----------------TQMRQSSSW---------------T----
A0A2K6N1A1_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
A0A2K6PUM5_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
A0A2K5HKW9_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
B4DZQ9_BAD-01           SAGTA----------------TQMRQSPRR---------------L----
A0A2K6GWV0_BAD-01       SAGTA----------------TQIRQSSSW---------------T----
F6SJL0_BAD-01           SAGTA----------------TQMRQSSSW---------------T----
A0A2I3MCN5_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
A0A2I2Z8C7_BAD-02       SAGTA----------------TQMRQSSSW---------------T----
A0A2I2Z8C7_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
Q92934_BAD-01           SAGTA----------------TQMRQSSSW---------------T----
Q92934_BAD-02           SAGTA----------------TQMRQSSSW---------------T----
A0A2I3TBK7_BAD-02       SAGTA----------------TQMRQSSSW---------------T----
A0A2R8Z697_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
A0A2J8TYJ3_BAD-01       SAGTA----------------TQMRQSSSW---------------T----
F1PK10_BAD-01           SAGTA----------------TQMRQSPSW---------------T----
Q45KI9_BAD-01           SAGTA----------------TQMRQSPSW---------------T----
I3MBM5_BAD-01           SAGTA----------------SQMRQSSSW---------------T----
I3MBM5_BAD-02           ---------------------------------------------V----
Q61337_BAD-05           CDGT----------------------------------------------
Q61337_BAD-04           SAGTA----------------TQMRQSAGW---------------T----
Q61337_BAD-03           SAGTA----------------TQMRQSAGW---------------T----
Q61337_BAD-06           SAGTA----------------TQMRQSAGW---------------T----
Q61337_BAD-02           ---------------------EELTYSLSP---------------F----
Q61337_BAD-01           SAGTA----------------TQMRQSAGW---------------T----
I3LVX0_BIK-01           Q-------------------------------------------------
A0A3G3M2M0_BCL2L11      NNRAQL---HAPNEHAIIMWMN----------------------------
A0A3Q1ELG4_BCL2L11      QQHGELNDCRSCGQRKTSLTFS-----AVV---------------FALAI
A0A3Q1CI15_BCL2L11      QQHGEL---RLTYTREISCTFNLCNSFCTL---------------FSVTV
O61667_EGL1-01          DRSLFHRLLDFFAF------------------------------------
Q9BXH1_BBC3-03          --QSHHGT------------------------------------------
F6TGJ4_BMF-01           --QRLQQNRN------QFWS------------------------------
A0A452H3N6_BMF-01       --QRHQQNRN------QVWW------------------------------
G1PAU1_BMF-01           --QQHQQNRN------RMWW------------------------------
A2AV74_BMF-02           --QQHQQNRD------RAWW------------------------------
A0A286XXB0_BMF-03       --QQHQQNRN------RAWW------------------------------
I3MDS9_BMF-02           --QQHQQNRN------RVWW------------------------------
A0A287AIU8_BMF-05       --QQEFPS----------WL------------------------------
A0A287AIU8_BMF-04       --QQHQQNQN------RVWW------------------------------
A0A287AIU8_BMF-03       --QQHQQNQN------RVWW------------------------------
A0A287AIU8_BMF-01       --QQHQQNQN------RVWW------------------------------
A0A287AIU8_BMF-02       --QQHQQNQN------RVWW------------------------------
A0A2K5KGR6_BMF-01       --EHRQEGHR------AGLT------------------------------
A0A2K6FFR1_BMF-02       --------------------------------------------------
M3WRS0_BMF-02           --------------------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
F7HPK0_BMF-02           --------------------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
G3QIN5_BMF-02           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
G7PAW6_BMF-01           --------------------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A2AV74_BMF-01           --QQHQQNRD------RAWW------------------------------
Q8K589_BMF-01           --QQHQQNRD------RAWR------------------------------
I3MDS9_BMF-01           --QQHQQNRN------RVWW------------------------------
G3T7Z4_BMF-01           --QRHQQNRN------PAWR------------------------------
F6X3N6_BMF-01           --QRHQQNRN------HVWW------------------------------
G3WDQ2_BMF-01           --QRHQQNQN------HVWW------------------------------
Q96LC9_BMF-06           ----HQQNQN------RVWW------------------------------
F6TJI0_BMF-02           --QQHQQNRN------RVWW------------------------------
F6TJI0_BMF-01           --QQHQQNRN------RVWW------------------------------
A0A286XXB0_BMF-02       --QQHQQNRN------RAWW------------------------------
J9PB65_BMF-01           --QQHQQNQN------RVWW------------------------------
A0A286XXB0_BMF-01       --QQHQQNRN------RAWW------------------------------
G1SR62_BMF-01           --QQHQQNRN------RVWW------------------------------
W5QFV1_BMF-01           --QQHQQNRN------RMWW------------------------------
Q05KI3_BMF-01           --QQYQQNRN------RMWW------------------------------
Q05KI3_BMF-02           --QQYQQNRN------RMWW------------------------------
A0A452F2E0_BMF-02       --QQHQQNRN------RMWW------------------------------
A0A452F2E0_BMF-01       --QQHQQNRN------RMWW------------------------------
M3WRS0_BMF-01           --QQHQQNRR------RVWW------------------------------
A0A2U4BC98_BMF-01       --QQHQQNRN------RVWW------------------------------
M3YAD5_BMF-01           --QQHQQNQN------RVWW------------------------------
A0A452SED0_BMF-01       --QQHQQNQN------RVWW------------------------------
A0A384D070_BMF-01       --QQHQQNQN------RVWW------------------------------
A0A2K6FFR1_BMF-01       --QQHQQNQN------RMWW------------------------------
H0WYH6_BMF-01           --QQHQQNQN------RVWW------------------------------
A0A096NTE9_BMF-01       --QQHQQNRN------RVWW------------------------------
A0A2K6L933_BMF-02       --QQHQQNRN------RVWW------------------------------
A0A096NTE9_BMF-02       --QQHQQNRN------RVWW------------------------------
A0A2K5MJY6_BMF-02       --QQHQQNRN------RVWW------------------------------
A0A2K5KGR6_BMF-02       --QQHQQNRN------RVWW------------------------------
G7PAW6_BMF-02           --QQHQQNRN------RVWW------------------------------
F7CM09_BMF-02           --QQHQQNRN------RVWW------------------------------
A0A2K6B5G4_BMF-01       --QQHQQNRN------RVWW------------------------------
A0A2K6B5G4_BMF-02       --QQHQQNRN------RVWW------------------------------
A0A2K6B5G4_BMF-04       --QQHQQNRN------RVWW------------------------------
A0A2K5Z4C3_BMF-01       --QQHQQNRN------RVWW------------------------------
A0A2K6L933_BMF-03       --QQHQQNRN------RVWW------------------------------
A0A2K6L933_BMF-01       --QQHQQNRN------RVWW------------------------------
A0A2K6RAW8_BMF-01       --QQHQQNRN------RVWW------------------------------
A0A0D9R4R5_BMF-01       --QQHQQNRN------RMWW------------------------------
F7HPK0_BMF-01           --QQHQQNRN------RMWW------------------------------
A0A2K5E1W9_BMF-01       --QQHQQNRN------RVWW------------------------------
A0A2K6TW86_BMF-02       --QQHQQNRN------RVWW------------------------------
A0A2K6TW86_BMF-01       --QQHQQNRN------RVWW------------------------------
G3QIN5_BMF-01           --QQHQQNQN------RVWW------------------------------
Q96LC9_BMF-01           --QQHQQNQN------RVWW------------------------------
Q96LC9_BMF-04           --QQHQQNQN------RVWW------------------------------
Q96LC9_BMF-03           --QQHQQNQN------RVWW------------------------------
Q96LC9_BMF-02           --QQHQQNQN------RVWW------------------------------
A0A2R9BS98_BMF-01       --QQHQQNQN------RVWW------------------------------
A0A2J8QDD5_BMF-02       --QQHQQNQN------RVWW------------------------------
A0A2J8T301_BMF-01       --QQHQQNRN------RVWW------------------------------
H9GL49_BMF-01           --QRHQQNRN------QVWW------------------------------
K7FRX2_BMF-01           --QRHQQNRN------QVWW------------------------------
A9XRG9_BMF-01           --QRVGCFHR------GRWG------------------------------
A9XRG9_BMF-02           --QRVGCFHR------GRWG------------------------------
U3JS06_BMF-01           --QRHQQNRN------QVWW------------------------------
H0ZMX5_BMF-01           --QRHQQNRN------QVWW------------------------------
A9XRG9_BMF-03           --QRHQQNRN------QVWW------------------------------
A9XRG9_BMF-04           --QRHQQNRN------QVWW------------------------------
G1NHG8_BMF-01           --QRHQQNRN------QVWW------------------------------
A0A3B4UNJ0_BMF-01       --MRHQRQNL------PAWM------------------------------
B2KKY9_BCL2L11-01       QLRAPNEHAI------VLWM------------------------------
B8JK68_BCL2L11-01       QLHAPNEHAI------VLWM------------------------------
A0A3B4B6Y3_BMF-01       --REH---------------------------------------------
Q0GKC7_BMF-01           --MHHQRPQD------PLWR------------------------------
A0A3B3RH63_BMF-01       --HRNQRNQQ------PVWW------------------------------
W5N4P7_BMF-01           --RRNQRNHQ------PMWW------------------------------
A0A3B1K1X5_BMF-01       --HRNQRNQQ------PLWL------------------------------
A0A3B4CNJ8_BMF-01       --HRNQRNQQ------PFWL------------------------------
A0A2U9CJH3_BMF-01       --HRNQRNQG------PLWW------------------------------
A0A3Q2YCX7_BMF-01       --SRNQHKHK----------------------------------------
A0A3Q2YCX7_BMF-02       --SRNQHKHK----------------------------------------
A0A3P8ZIE7_BMF-01       --HRNQRNLR------PLWW------------------------------
A0A3Q3QZ16_BMF-01       --HRNQRNQG------PLWW------------------------------
A0A3Q3QZ16_BMF-02       --HRNQRNQG------PLWW------------------------------
A0A3Q2PJX9_BMF-02       --GSFRSSLAAGEVGKPMYYTNVYSQCPTC---------------WLANC
A0A3Q2PJX9_BMF-03       --HQNQRNQG------PLWW------------------------------
A0A3Q2PJX9_BMF-01       --HQNQRNQG------PLWW------------------------------
A0A3B5QK08_BMF-01       --QQNQRNQG------PLWW------------------------------
A0A3B5QK08_BMF-02       --QQNQRNQG------PLWW------------------------------
A0A096LRV0_BMF-01       --QQNQRNQG------PLWW------------------------------
A0A3B3WU80_BMF-01       --QQNQRNQG------PLWW------------------------------
A0A3P9Q8E2_BMF-01       --QQNQRNQG------PLWW------------------------------
A0A3Q2E3E8_BMF-02       FPHLVHQHQALTLPPLPVYF------------------------------
A0A3Q2E3E8_BMF-01       --HQNQRNQG------PLWW------------------------------
A0A3Q3GUU5_BMF-01       --HRNQRNQG------PLWW------------------------------
A0A3B5B8F6_BMF-01       --HRNQRNQG------PLWW------------------------------
A0A3P8UA78_BMF-01       --HRNQRNHG------PLWW------------------------------
A0A3P8UA78_BMF-03       --HRNQRNHG------PLWW------------------------------
A0A3P8UA78_BMF-02       --HRNQRNHG------PLWW------------------------------
A0A3B3CGR9_BMF-01       --HQNQRNQG------PLWW------------------------------
A0A3B3I0V9_BMF-04       --HRNQRNQG------PVWW------------------------------
A0A3B3I0V9_BMF-02       --HRNQRNQG------PVWW------------------------------
A0A3B3I0V9_BMF-01       --HRNQRNQG------PVWW------------------------------
A0A3B3I0V9_BMF-03       --HRNQRNQG------PVWW------------------------------
A0A3P9JM16_BMF-03       --HRNQRNQG------PVWW------------------------------
A0A3P9JM16_BMF-02       --HRNQRNQG------PVWW------------------------------
A0A3P9JM16_BMF-01       --HRNQRNQG------PVWW------------------------------
A0A3Q2ZA20_BMF-01       --HRNQRNQG------PLWW------------------------------
A0A3P8NFE2_BMF-02       --KASRIQT--------CWL------------------------------
I3K2D6_BMF-01           --HRNQRNQG------PMWW------------------------------
A0A3P8NFE2_BMF-01       --HRNQRNQG------PMWW------------------------------
A0A3Q3C5V2_BMF-01       --HRNQRNQG------PMWW------------------------------
A0A3P9DPJ5_BMF-02       --HRNQRNQG------PMWW------------------------------
A0A3P9DPJ5_BMF-01       --HRNQRNQG------PMWW------------------------------
A0A3B4ETH0_BMF-01       --HRNQRNQG------PMWW------------------------------
A0A3Q4G1I4_BMF-01       --QRNQRNQG------PMWW------------------------------
A0A3Q1FVH7_BMF-01       --HRNQRNQG------PLWW------------------------------
A0A3Q1FVH7_BMF-02       --HRNQRNQG------PLWW------------------------------
A0A3Q1D1K3_BMF-01       --HRNQRNQG------PLWW------------------------------
A0A3P8RKY9_BMF-01       --HRNQRNQG------PLWW------------------------------
A0A3Q1IPR4_BMF-01       --HRNQRNQG------PLWW------------------------------
A0A3B4U5H8_BMF-01       --HQNQRNQG------PLWW------------------------------
A0A3B4WM88_BMF-01       --HQNQRNHG------PLWW------------------------------
A0A3Q3LME3_BMF-01       ---------Q------VGWA------------------------------
A0A3Q3LME3_BMF-02       --HLNQRNQG------LLWW------------------------------
A0A3Q3LME3_BMF-03       --HLNQRNQG------LLWW------------------------------
A0A3Q3VLX6_BMF-01       --HRNQRNQG------PLWW------------------------------
A0A3B5KWG6_BMF-01       --QRNQRNQG------PLWW------------------------------
A0A286XF37_PMAIP1-      LISLVT--------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
F1SMU1_PMAIP1-01        LFRLGT--------------------------------------------
A0A3B3QC78_BCL2L11      CPHCPLRPTAMGQGATLTPY------------------------------
A0A3Q2U844_BCL2L11      NR----AGN--PQVVILRLL------------------------------
G3SU55_BCL2L11-01       NNYQAAEDH--PQMVILRLL------------------------------
G3W979_BCL2L11-01       NNYQAADDH--HQMVILRLL------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
C1C3S9_BAD-01           RRKNKDRSQSENDKH-----------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
F6Z067_BAD-01           FSRRKSKGRDESGDEE----------------------------------
A0A3Q2LHE3_BIK-01       VG---------HSLAGCHSP------------------------------
A0A452QUG1_BIK-01       LG---------WGFRLLQ--------------------------------
A0A452V3L2_BIK-01       RS---------CPLPAAPSG------------------------------
M3XHJ5_BCL2L11-01       LAQREQHPETHGKNPLNFT-------------------------------
W5QCU2_BIK-01           LS---------WGCRF----------------------------------
O70337_BIK-04           LG---------GAWYLQLQ-------------------------------
O70337_BIK-01           LG---------GAWYLQLQ-------------------------------
O70337_BIK-02           LG---------GAWYLQLQ-------------------------------
Q925D2_BIK-01           LG---------GAWHLQLQ-------------------------------
G1TZR9_BIK-01           GA---------GSWGLRMP-------------------------------
H0W025_BIK-01           L----------GTLRLLLQ-------------------------------
A0A2K5CLG5_BIK-01       FS---------GGLHLLLK-------------------------------
F7FUT7_BIK-01           FS---------GGLHLLLK-------------------------------
A0A2K6TBD7_BIK-01       FS---------GGLRLLLK-------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           LS---------GGLYLLN--------------------------------
G3QCT2_BIK-01           LS---------GGLHLLLK-------------------------------
A0A2R8ZXD2_BIK-01       LS---------GGLHLLLK-------------------------------
H2QLU7_BIK-01           LS---------GGLHLLLK-------------------------------
Q13323_BIK-01           LS---------GGLHLLLK-------------------------------
A0A2K6MCW0_BIK-01       LS---------GGLHLLLK-------------------------------
A0A2K6QK74_BIK-01       LS---------GGLHLLLK-------------------------------
A0A0D9QZY8_BIK-01       LS---------GGLHLLLK-------------------------------
A0A2K5VW94_BIK-01       LS---------GGLHLLLK-------------------------------
A0A2K6DBJ4_BIK-01       LS---------GGLHLLLK-------------------------------
A0A2K5J4Q7_BIK-01       LS---------GGLHLLLK-------------------------------
A0A096NKG5_BIK-01       LS---------GGLHLLLK-------------------------------
A0A2K5LDM6_BIK-01       LS---------GGLHLLLK-------------------------------
A0A2K5XSA1_BIK-01       LS---------GGLHLLLK-------------------------------
F1PUF4_BIK-01           LG---------WGLRLLQ--------------------------------
H0XAE7_BIK-01           LA---------GGLHLLLK-------------------------------
A0A2K6FM79_BIK-01       LG---------GGLHLLLK-------------------------------
A0A3P8XIA2_BCL2L11      SKMPVLHHLIYKPYQGPHCI------------------------------
F7G1G0_HRK-01           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       NQAI-------NHQIVLRLL------------------------------
A0A3Q2GRS5_BCL2L11      HHQAAEAH---PQMIILRLL------------------------------
Q4KMV9_BCL2L11-01       NLPRPLDN---DQVIILRVL------------------------------
F7FTC8_BCL2L11-01       NNNPAGNN---HQMGFVHLL------------------------------
A0A2K6E226_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       DYREAEDH---PQMVILQLL------------------------------
O54918_BCL2L11-08       DYREAEDH---PQMVILQLL------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       SLPPFSPHTLPPPYI-----------------------------------
A0A2K6GE31_BCL2L11      LVPSI---------------------------------------------
A0A337SW42_BCL2L11      PASYI---------------------------------------------
O43521_BCL2L11-17       PD------------------------------------------------
O43521_BCL2L11-10       PD------------------------------------------------
A0A2I2YQ13_BCL2L11      LASST---------------------------------------------
O43521_BCL2L11-19       LASST---------------------------------------------
O43521_BCL2L11-13       LASST---------------------------------------------
A0A2I3HW02_BCL2L11      LASST---------------------------------------------
A0A2R9CA99_BCL2L11      LSST----------------------------------------------
A0A2J8JCT2_BCL2L11      LASST---------------------------------------------
A0A2K5NU92_BCL2L11      LASST---------------------------------------------
A0A2K5X2I7_BCL2L11      LASST---------------------------------------------
F7HHA9_BCL2L11-05       LASST---------------------------------------------
A0A2K5Z8B6_BCL2L11      LASST---------------------------------------------
A0A2K5HZI7_BCL2L11      LASST---------------------------------------------
A0A2K6KJP8_BCL2L11      LASST---------------------------------------------
A0A2K6QIL2_BCL2L11      LASST---------------------------------------------
O54918_BCL2L11-05       DYREAEDH---PQMVILQLL------------------------------
O88498_BCL2L11-02       DYREAEDH---PQMVILQLL------------------------------
A0A0D9RWE0_BCL2L11      ------EK------------------------------------------
O43521_BCL2L11-05       ------EK------------------------------------------
O43521_BCL2L11-25       ------EK------------------------------------------
F1SU81_BCL2L11-03       SLPPFSPHTLPPPYI-----------------------------------
A0A2K6GE31_BCL2L11      NYQADEDH---PQMLILRLL------------------------------
A0A286XJN2_BCL2L11      HYQPAEDQ---PQMVILRLL------------------------------
A0A2K5CAB2_BCL2L11      NYQAAEDH---PHMVILRLL------------------------------
A0A2K6TRZ5_BCL2L11      NYQAAEDH---PHMVILRLL------------------------------
A0A2K6QIL2_BCL2L11      NYQAAEEH---PQMVILRLL------------------------------
A0A2K5NU92_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2K5HZI7_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2K5X2I7_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2K6E226_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2K5Z8B6_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2I3M6I1_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2I3M6I1_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2K6KJP8_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2I2YQ13_BCL2L11      NYQAAEDH---PRMVILRLL------------------------------
O43521_BCL2L11-02       NYQAAEDH---PRMVILRLL------------------------------
A0A2R9CA99_BCL2L11      NYQAAEDH---PRMVILRLL------------------------------
A0A2J8JCT2_BCL2L11      NYQAAEDH---PRMVILRLL------------------------------
H2P5E2_BCL2L11-01       NYQAAEDH---PRMVILRLL------------------------------
A0A337SW42_BCL2L11      NYQAAEAQ---PQMIILRLL------------------------------
A0A452SBG5_BCL2L11      NYQAAEAH---PQMIILRLL------------------------------
Q2YDF0_BCL2L11-01       H-QAVEGH---PQMVLLRVL------------------------------
A0A287DFJ0_BCL2L11      N-YQPEDR---PQMVILRLL------------------------------
Q2YDF0_BCL2L11-03       H-QAVEGH---PQMVLLRVL------------------------------
A0A452FCS1_BCL2L11      H-QAIEGH---PQMVLLRVL------------------------------
A0A2K5CAB2_BCL2L11      HHSQGTEQLHHKYFS-----------------------------------
A0A2K5Z8B6_BCL2L11      HHSQDTEQLNHKDFS-----------------------------------
A0A2K6KJP8_BCL2L11      HHSQDTEQLNHRDFS-----------------------------------
A0A2K6QIL2_BCL2L11      HHSQDTEQLNHRDFS-----------------------------------
F6XMC1_BCL2L11-09       HHSQGTEQQHKDFSW-----------------------------------
A0A2K6TRZ5_BCL2L11      HHSQGTEQLHHKYVS-----------------------------------
A0A2K5HZI7_BCL2L11      HHSQDTEQLNHRDFS-----------------------------------
A0A2R9CA99_BCL2L11      HHSQDAEQLNHKDFS-----------------------------------
A0A2J8JCT2_BCL2L11      HHSQDAEQLNHKDFS-----------------------------------
A0A2K5NU92_BCL2L11      HHSQDTEQLNHKDFS-----------------------------------
A0A2K5X2I7_BCL2L11      HHSQDTEQLNHKDFS-----------------------------------
F7HHA9_BCL2L11-09       HHSQDTEQLNHKDFS-----------------------------------
A0A2K6E226_BCL2L11      HHSQDTEQLNHKDFS-----------------------------------
A0A2I3M6I1_BCL2L11      HHSQDTEQLNHKDFS-----------------------------------
A0A2I2YQ13_BCL2L11      HHSQDTEQLNHKDFS-----------------------------------
O43521_BCL2L11-06       HHSQDTEQLNHKDFS-----------------------------------
O43521_BCL2L11-23       HHSQDTEQLNHKDFS-----------------------------------
A0A2I3HW02_BCL2L11      HHSQDTEQFNHKDFS-----------------------------------
M3YDI3_BCL2L11-01       NYPAAEAH---PQMIILRLL------------------------------
F6XMC1_BCL2L11-02       LPFCHRKEVCLEAFPVLPSK------------------------------
F6XMC1_BCL2L11-01       LPFCHRKEVCLEAFPVLPSK------------------------------
F7CXT2_BCL2L11-01       NNYQGAGDH--HQMVILRLL------------------------------
O54918_BCL2L11-01       DYREAEDH---PQMVILQLL------------------------------
O88498_BCL2L11-01       DYREAEDH---PQMVILQLL------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       SARNSIHP------------------------------------------
A0A2K6GE31_BCL2L11      NYQADEDH---PQMLILRLL------------------------------
A0A2K6GE31_BCL2L11      SD------------------------------------------------
A0A287DFJ0_BCL2L11      NYQPEDR----PQMVILRLL------------------------------
A0A286XJN2_BCL2L11      HYQPAEDQ---PQMVILRLL------------------------------
A0A286XJN2_BCL2L11      HYQPAEDQ---PQMVILRLL------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       PD------------------------------------------------
A0A2K6TRZ5_BCL2L11      PD------------------------------------------------
A0A2K5CAB2_BCL2L11      SD------------------------------------------------
A0A2K5NU92_BCL2L11      PD------------------------------------------------
A0A2K5HZI7_BCL2L11      PD------------------------------------------------
A0A2K5X2I7_BCL2L11      PD------------------------------------------------
F7HHA9_BCL2L11-02       PD------------------------------------------------
A0A2K6E226_BCL2L11      PD------------------------------------------------
A0A2K5Z8B6_BCL2L11      PD------------------------------------------------
A0A2I3M6I1_BCL2L11      PD------------------------------------------------
A0A2K6KJP8_BCL2L11      PD------------------------------------------------
A0A2K6QIL2_BCL2L11      PD------------------------------------------------
A0A2I2YQ13_BCL2L11      PD------------------------------------------------
O43521_BCL2L11-09       PD------------------------------------------------
O43521_BCL2L11-21       PD------------------------------------------------
A0A2R9CA99_BCL2L11      PD------------------------------------------------
A0A2J8JCT2_BCL2L11      PD------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      NYQAAEDH---PHMVILRLL------------------------------
A0A2K5CAB2_BCL2L11      NYQAAEDH---PHMVILRLL------------------------------
F6XMC1_BCL2L11-03       NYQAAEDH---PHMVILRLL------------------------------
A0A2K6TRZ5_BCL2L11      NYQAAEDH---PHMVILRLL------------------------------
A0A2K6TRZ5_BCL2L11      NYQAAEDH---PHMVILRLL------------------------------
A0A2K6QIL2_BCL2L11      NYQAAEEH---PQMVILRLL------------------------------
A0A2K6QIL2_BCL2L11      NYQAAEEH---PQMVILRLL------------------------------
A0A2K5NU92_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2K5HZI7_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2K5X2I7_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2K6E226_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2K6E226_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2K5Z8B6_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2I3M6I1_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2K6KJP8_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2K6KJP8_BCL2L11      NYQAAEDH---PQMVILRLL------------------------------
A0A2I2YQ13_BCL2L11      NYQAAEDH---PRMVILRLL------------------------------
O43521_BCL2L11-03       NYQAAEDH---PRMVILRLL------------------------------
A0A2I3HW02_BCL2L11      NYQAAEDH---PRMVILRLL------------------------------
A0A2R9CA99_BCL2L11      NYQAAEDH---PRMVILRLL------------------------------
A0A2J8JCT2_BCL2L11      NYQAAEDH---PRMVILRLL------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A452FCS1_BCL2L11      RHQAIEGH---PQMVLLRVL------------------------------
W5PY58_BCL2L11-01       RHQAIEGH---PQMVLLRVL------------------------------
Q2YDF0_BCL2L11-02       RHQAVEGH---PQMVLLRVL------------------------------
F1SU81_BCL2L11-02       SLPPFSPHTLPPPYI-----------------------------------
G1SSY0_BCL2L11-01       NYPAAEEQ---PQMVILRLL------------------------------
H0XW23_BCL2L11-01       NYQAAEDH---PQMVILRLL------------------------------
A0A337SW42_BCL2L11      NYQAAEAQ---PQMIILRLL------------------------------
G1LDR8_BCL2L11-01       NYQAAEAH---PQMIILRLL------------------------------
J9NWV6_BCL2L11-01       NYQAAEAH---PQMIILRLL------------------------------
F1SU81_BCL2L11-01       NYQAAEAH---PQMVILRLL------------------------------
                                                                          

A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
K7E5Y2_BBC3-01          --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2K5F6X4_BBC3-02      ----------------VLYNLIMGLLPFPRGHRAPEMEPN----------
A0A337SQV0_BBC3-03      ----------------VLYNLIMGLLPLPRARGAPEMEPN----------
A0A3P8RLE2_BCL2L11      ----------------NVLIRFINPNYFSTFWKRC---------------
A0A3B1JLM2_BAD-01       ----------------SFLWGTKEEEGRE---------------------
A0A3Q2LHE3_BIK-02       RRDRVSLRFHDLDSPSCMCSPLEPWSSCPVGHSLAGCHSPHQSLLSSFAC
E7FBJ6_BAD-01           ----------------SFLWSPKEEEGR--------------E-------
B5XEF1_BAD-01           ----------------SFLWSPKEAEGR--------------E-------
H3D8J8_BAD-01           ----------------SYLFSHQETESE---NNHHD--------------
A0A3B5L9R9_BAD-01       ----------------SYLFSHQETEGE---NNHHENHASRTE-------
Q9GL49_PMAIP1-01        ----------------LNLIAKLFRLGT----------------------
A0A3B1IH05_BAD-01       ----------------AFLWSHKESDSE-------ASSSRPAE-------
A0A3Q2QC80_BAD-01       ----------------NYLFSHQETEGE---NSHHENHAPRTE-------
A0A3Q3MLA0_BAD-02       ----------------DYLILIITLHSS---L------------------
A0A3Q3MLA0_BAD-03       ----------------SYLFSHQETEGE---NNHHENHTHRNE-------
I3K7B6_BAD-01           ----------------SYLFSHQETEGE---NNHLE--------------
A0A3P9B2E4_BAD-01       -------------------VRMGVSQGL---N------------------
A0A3Q3C680_BAD-01       ----------------SYLFSHQETEGE---NNHLENHNQRTE-------
A0A3P8QRJ7_BAD-01       ----------------SYLFSHQETEGE---NNHLENHNQRTE-------
A0A3Q4GGN3_BAD-01       ----------------SYLFSHQETEGE---NNHLENHNQRTE-------
A0A3B4GXJ6_BAD-01       ----------------SYLFSHQETEGE---NNHLENHNQRTE-------
A0A3Q2D5S0_BAD-01       ----------------SYLFSHQEMEGE---NSHHENHTQCTEQRGE---
A0A3B3BQF7_BAD-01       ----------------NYLFSHPEAEGE---YSHHESH--RTE-------
A0A3Q1K1C7_BAD-02       ----------------SYLFSHQETEGE---NNHHESHTHRTE-------
A0A3Q1K1C7_BAD-01       ----------------SYLFSHQETEGE---NNHHESHTHRTE-------
A0A3Q1GWH9_BAD-01       ----------------SYLFSHQEMEGE---NNHHESHTHRNE-------
A0A3Q1CPU7_BAD-01       ----------------SYLFSHQEMEGE---NNHHESHTHRNE-------
A0A3P8TWH6_BAD-01       ----------------SYLFSHQEMEGE---NNHHESHTHRNE-------
A0A2U9BAC9_BAD-01       ----------------SYLFSHQEMEGE---NNHHENHTQRNE-------
A0A3B4VFC5_BAD-01       ----------------SYLFSHQETEGE---NNHHENHTHRTE-------
A0A3B4W9T1_BAD-01       ----------------SYLFSHQETEGE---NNHHENHTHRTE-------
A0A3Q0QNQ2_BAD-01       ----------------SYLFSHQESDGE---NSHHENHTQRTE-------
A0A3P8WIZ8_BAD-02       ----------------SYLFSHQELEGE---NNHHENHTHRTE-------
A0A3P8WIZ8_BAD-01       ----------------SYLFSHQELEGE---NNHHENHTHRTE-------
A0A3P9A5G8_BAD-02       ----------------SFLWSPKEAEGR--------------D-------
A0A3P9A5G8_BAD-01       ----------------SFLWSPKEAEGR--------------D-------
B5X1T1_BAD-01           ----------------SFLWSPKKAEGR--------------E-------
H3ANP3_BAD-03           ----------------KKLIRSLKGRGQ-----PRDPPGQ----------
H3ANP3_BAD-04           ----------------KKLIRSLKGRGQ-----PRDPPGQ----------
H3ANP3_BAD-02           ----------------KKLIRSLKGRGQ-----PRDPPGQQGVSIRGPD-
H3ANP3_BAD-01           ----------------KKLIRSLKGRGQ-----PRDPPGQQGVSIRGPD-
A0A3B3QX41_BAD-01       ----------------AFLWSHKESDAE-ISGSLSTADSRAAQ-------
Q4V925_BAD-02           ----------------AFLWSHKESDAE----------SRPAE-------
Q4V925_BAD-03           ----------------AFLWSHKESDAE----------SRPAE-------
A7MCM4_BAD-01           ----------------AFLWSHKESDAE----------SRPAE-------
Q4V925_BAD-04           ----------------AFLWSHKESDAE----------SRPAE-------
Q4V925_BAD-01           ----------------AFLWSHKESDAE----------SRPAE-------
A0A3P8Y761_BAD-01       ----------------AFLFSHKETETE-KTPNLIITEPRSSE-------
A0A3B5K831_BAD-01       ----------------SYLFSHQETEGE---NGHHDGHTHRTE-------
A0A3B5Q2N7_BAD-01       ----------------SYLFSHQETEGE---NNHHENHASRTE-------
A0A087X8P8_BAD-01       ----------------SYLFSHQETEGE---NNHHENHASRTE-------
A0A3B3UA11_BAD-01       ----------------SYLFSHQETEGE---NNHHENHASRTE-------
A0A3B3YFR1_BAD-01       ----------------SYLFSHQETEGE---NNHHENHASRTE-------
A0A3P9Q7C3_BAD-01       ----------------SYLFSHQETEGE---NNHHENHASRTE-------
A0A3B3HDU2_BAD-01       ----------------NYLFSHPEAEGE---YSHHE--SHRTE-------
A0A3B5BAL2_BAD-01       ----------------SYLFSHQELEGE---NNHHENHTHRNE-------
A0A3Q3AEL8_BAD-02       ----------------NYLFSHQETDGE---SSHHEKPTHRTE-------
A0A3Q3AEL8_BAD-01       ----------------NYLFSHQETDGE---SSHHEKPTHRTE-------
G3Q8B3_BAD-01           ----------------SSLFSHQEMEGE---NNHHE--------------
A0A3Q2Y0E4_BAD-01       ----------------SYLFSHQETEGENNNNNHHDNHANRTE-------
A0A3Q3R5S3_BAD-01       ----------------SYLFSHQETEGE---NTHHENAALAQEVERVVS-
A0A3Q3RXS8_BAD-02       ----------------SYLFSYQETDGE---NNLHENHTPRTE-------
A0A3Q3RXS8_BAD-01       ----------------SYLFSYQETDGE---NNLHENHTPRTE-------
A0A3Q0QNQ2_BAD-02       ----------------SYLFSHQESDGE---NSHHENHTQRTE-------
A0A3Q3WTY4_BAD-01       ----------------SYLFSHQETDGE---NNHHDSHTHRNE-------
A0A3B1JXK6_BCL2L11      ----------------LWMGLLIERLRQFLHRRR----------------
A0A3B4BVX1_BCL2L11      ----------------SILGLF---------RGH----------------
A0A3B4BVX1_BCL2L11      ----------------ALSARDLHDQMFALS-------------------
A0A3B4BVX1_BCL2L11      -------------LWLGLVIRRLLEVLLRRR-------------------
A0A3P8XIA2_BCL2L11      -------------LWMGLLIGRLLQIIWRRR-------------------
A0A3Q1ICY2_BCL2L11      -------------LCVGLLLFVIGRIIYSQGSTNSEGHSHV---------
A0A3Q3K6I5_BCL2L11      -------------LCVGILVLVIGQIIL-QGSINSQDNSQV---------
A0A3B4V919_BCL2L11      -------------FC-----------------------------------
A0A3B4XZH1_BCL2L11      -------------VCVCACGCVCACGCVCGCVRVCGGGGGVE--------
A0A3Q3ESW6_BCL2L11      -------------LCTGLMILLIGWIIYLRGNTNSHDHSQV---------
A0A3Q2SZH6_BCL2L11      -------------LCVGLLLLLIGRIMYLQGSTNSHDHSQV---------
A0A3B3VNE0_BCL2L11      -------------LCVCLLLLLVGRIMYMQGNTSSHDHSQV---------
A0A3B3YII5_BCL2L11      -------------LCVCLLLLLVGRIMYMQGNTSSHDHSQV---------
A0A3B3YII5_BCL2L11      -------------LCVCLLLLLVGRIMYMQGNTSSHDHSQV---------
A0A3P9N073_BCL2L11      RKRVGYDDDYYHYYIDCFFLKSVSKYDVA---------------------
A0A3Q3B113_BCL2L11      -------------LCVSLLLLLIGRLMYLQGCTNSQNNSQV---------
A0A3B5M375_BCL2L11      -------------L-VPIYHASTLRISALE--------------------
A0A3B5QAM1_BCL2L11      -------------LCVCLLLLLVGRIMYMQGNTSSHDHSQV---------
A0A3B5QAM1_BCL2L11      -------------LCVCLLLLLVGRIMYMQGNTSSHDHSQV---------
A0A2I3HWI8_BBC3-03      ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A2K6FQZ3_BBC3-04      ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
Q9BXH1_BBC3-05          ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A2R9BZA9_BBC3-01      ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A2I3RGH5_BBC3-03      ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A2K5P2T8_BBC3-03      ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A2K5V8J3_BBC3-03      ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
F7FFP6_BBC3-03          ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A2K6ASP2_BBC3-03      ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A2I3N2Z9_BBC3-03      ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A2K6QZU4_BBC3-04      ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A2R8MW85_BBC3-03      ----------------VLYNLIMGLLPFPRGHRAPEMEPN----------
A0A2K6STD6_BBC3-02      ----------------VLYNLIMGLLPFPRGHRAPEMEPN----------
G3T2N1_BBC3-01          ----------------VLYNLIMGLLPLPRDHGAPEMEPN----------
M3Y0R3_BBC3-01          ----------------VLYNLIMGLLPLPRGRGAPEMEPN----------
Q99ML1_BBC3-02          ----------------VMYNLFMGLLPLPRDPGAPEMEPN----------
Q80ZG6_BBC3-01          ----------------VMYNLFMGLLPLPRDPGAPEMEPN----------
H0XQ00_BBC3-01          ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A3Q2GWE8_BBC3-01      ----------------VLYNLIMGLLPLPRGRAAPEMEPN----------
A0A3Q1LXZ6_BBC3-01      ----------------VLYNLIMGLLPFPGGRGAPEVEPN----------
A0A452E3G1_BBC3-01      ----------------VLYNLILGLLPFPGGRGAPEVEPN----------
J9NTK9_BBC3-01          ----------------VLYNLIMGLLPLPRGRGAPEMEPN----------
A0A337SQV0_BBC3-02      ----------------VLYNLIMGLLPLPRARGAPEMEPN----------
F1RM01_BBC3-01          ----------------VLYNLIMGLLPLPRGRGAPEMEPN----------
A0A2K6FQZ3_BBC3-01      ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
Q9BXH1_BBC3-06          ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A2I3RGH5_BBC3-01      ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
H2NZD3_BBC3-01          ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A2K6QZU4_BBC3-01      ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A0D9S2H2_BBC3-01      ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
B4DQK3_BBC3-01          ----------------VLYNLIMGLLPLPRGHRAPEMEPN----------
A0A3Q3MLA0_BAD-01       ----------------QLLQPHVR-CVLGSLNVYKWDYLILIITLHSSL-
G1SS60_BAD-01           ----------------RVIQSWWD-RNLGKGGSAPSQ-------------
K7E5Y2_BBC3-02          ----------------LLY-------NLISGLLAPQRRNRMPDVEPN---
A0A3B4DUY7_BAD-01       ----------------QTNRGWFS-FLWGSKEEEGRE-------------
A0A337SAW2_BAD-01       ----------------RFIQSWWD-RNLGRGGSAPSQ-------------
A0A2I3TBK7_BAD-01       ----------------AYAK---------RGSVLSPLEGGLTPIPFRCV-
A0A2R8Z697_BAD-02       ----------------AYAK---------RGSVLSPLEGGLTQIPFRCV-
A0A2I2Z8C7_BAD-03       ----------------AYAK---------RGSVLSPLEGRLTQIPFRCV-
Q92934_BAD-03           ----------------AYAK---------RGSVLSPLEGGLTQIPFRCV-
A0A2K5M0C1_BAD-02       ----------------ALCK---------RGSVLPLSVGGLTQIPFRCM-
A0A2K5XJR2_BAD-02       ----------------ASCK---------RGSVLPLSVGGLTQIPFRCM-
A0A2I3MCN5_BAD-03       ----------------ALCK---------RGSVLPLSVGGLTQIPFRCM-
A0A2K5VCD8_BAD-02       ----------------ALCK---------RGSVLPLSVGGLTQIPFRCM-
F7GVS7_BAD-02           ----------------ALCK---------RGSVLPLSVGGLTQIPFRCM-
A0A2K6E7J3_BAD-02       ----------------ALCK---------RGSVLPLSVGGLTQIPFRCM-
A0A2K5E6K7_BAD-02       --------------------------------------GELTQIPFRCV-
A0A2K6TG62_BAD-02       --------------------------------------GGLTQIPFRCV-
A0A2K5E6K7_BAD-03       ----------------GAVRAQHP-PTSGQHSAMAASSGG----------
A0A2K5HKW9_BAD-02       ----------------GAARAPRP-LTSGQHSDMAASSGG----------
A0A2K6N1A1_BAD-02       ----------------GAARAPRP-LTSGQHSDMAASSGG----------
A0A2K6PUM5_BAD-02       ----------------GAARAPRP-LTSGQHSDMAASSGG----------
A0A2K5M0C1_BAD-03       ----------------GAARAPRP-PTSGQHSVMAASSGG----------
A0A2K5VCD8_BAD-03       ----------------GAARAPRP-PTSGQHSVMAASSGG----------
F7GVS7_BAD-03           ----------------GAARAPRP-PTSGQHSVMAASSGG----------
A0A2K5XJR2_BAD-03       ----------------GAARAPRP-PTSGQHSVMAASSGG----------
A0A2I3MCN5_BAD-02       ----------------GAARAPRP-PTSGQHSVMAASSGG----------
A0A2K6E7J3_BAD-03       ----------------GAARAPRP-PTSGQHSVMAASSGG----------
A0A2I2Z8C7_BAD-04       ----------------GAARARRP-PTSGQHSAMAASSGG----------
Q92934_BAD-04           ----------------GAARARRP-PTSGQHSAMAASSGG----------
A0A2I3TBK7_BAD-03       ----------------GAARARRP-PTSGQHSAMAASSGG----------
A0A2R8Z697_BAD-03       ----------------GAARARRP-PTSGQHSAMAASSGG----------
F6SJL0_BAD-02           ----------------GAVRARHP-PTSGQHSAMAASSGG----------
A0A2K6TG62_BAD-03       ----------------GAVRARHP-PTSGQHSDMAASSGG----------
G3VRY4_BAD-02           ----------------RTFQSWFG-RNLGKGSVGPSH-------------
G3VRY4_BAD-01           ----------------RTFQSWFG-RNLGKGSVGPSH-------------
G1P8C5_BAD-01           ----------------RFFQSWWD-RNSGRGGSAPSQ-------------
A0A452ER54_BAD-02       ----------------RFLQSWLS-RNLGRGGSAPSQ-------------
W5P8G9_BAD-01           ----------------RFLQSWLS-RNLGRGGSAPSQ-------------
G3TP47_BAD-01           ----------------RIIQAWWD-RNLGRGSSAPSQ-------------
G1MI17_BAD-01           ----------------RVIQSWWD-RNLGRGGSAPSQ-------------
A0A287AEF3_BAD-01       ----------------RFLQSWWY-RNSGRGGPAPSQ-------------
M3YNE7_BAD-01           ----------------RVIQSWWD-RNLGRGGSAPSQ-------------
A0A452RJM6_BAD-01       ----------------RVIQSWWD-RNLGRGGSAPSQ-------------
A0A384DJL2_BAD-01       ----------------RVIQSWWD-RNLGRGGSAPSQ-------------
A0A452ER54_BAD-01       ----------------RFLQSWLS-RNLGRGGSAPSQ-------------
F1MUT9_BAD-01           ----------------RFLQSWLS-RNLGRGGSAPSQ-------------
Q3SYZ0_BAD-01           ----------------RFLQSWLS-RNLGRGGSAPSQ-------------
F7DN67_BAD-01           ----------------RAIQSWWD-RNLGRGGSAPSQ-------------
O35147_BAD-01           ----------------RIIQSWWD-RNLGKGGSTPSQ-------------
H0WVR2_BAD-01           ----------------RVIQSWWD-RNVGRGGSAPCQ-------------
H0V608_BAD-01           ----------------RAIQSWWD-RNLGRGGSAPSQESV----------
A0A2K5E6K7_BAD-01       ----------------QVIQSWWD-RNLGRGGSAPSQ-------------
A0A2K6TG62_BAD-01       ----------------RVIQSWWD-RNLGRGGSAPSQ-------------
A0A0D9R491_BAD-01       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
A0A2K5M0C1_BAD-01       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
A0A2K5VCD8_BAD-01       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
F7GVS7_BAD-01           ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
A0A2K6E7J3_BAD-01       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
A0A2K5XJR2_BAD-01       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
A0A2I3MCN5_BAD-04       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
A0A2K6N1A1_BAD-01       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
A0A2K6PUM5_BAD-01       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
A0A2K5HKW9_BAD-01       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
B4DZQ9_BAD-01           ----------------R---------------------------------
A0A2K6GWV0_BAD-01       ----------------RVIQSWWD-RNVGRGGSAPSQ-------------
F6SJL0_BAD-01           ----------------RVIQSWWD-RNLGRGGSAPSQ-------------
A0A2I3MCN5_BAD-01       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
A0A2I2Z8C7_BAD-02       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
A0A2I2Z8C7_BAD-01       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
Q92934_BAD-01           ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
Q92934_BAD-02           ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
A0A2I3TBK7_BAD-02       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
A0A2R8Z697_BAD-01       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
A0A2J8TYJ3_BAD-01       ----------------RVFQSWWD-RNLGRGSSAPSQ-------------
F1PK10_BAD-01           ----------------RVIQSWWD-RNLGRGGSAPSQ-------------
Q45KI9_BAD-01           ----------------RVIQSWWD-RNLGRGGSAPSQ-------------
I3MBM5_BAD-01           ----------------RFIQSWWD-RNLGRRGSAPSQ-------------
I3MBM5_BAD-02           ----------------TFSQSPFL-RA-----------------------
Q61337_BAD-05           --------------------------------------------------
Q61337_BAD-04           ----------------RIIQSWWD-RNLGKGGSTPSQ-------------
Q61337_BAD-03           ----------------RIIQSWWD-RNLGKGGSTPSQ-------------
Q61337_BAD-06           ----------------RIIQSWWD-RNLGKGGSTPSQ-------------
Q61337_BAD-02           ----------------RCVQ------------------------------
Q61337_BAD-01           ----------------RIIQSWWD-RNLGKGGSTPSQ-------------
I3LVX0_BIK-01           --------------------------------------------------
A0A3G3M2M0_BCL2L11      ---------DLIGRVVQFFLRRR---------------------------
A0A3Q1ELG4_BCL2L11      VC---PCLLSFLFTVCFRFCNKRVK-------------------------
A0A3Q1CI15_BCL2L11      FCHLQSLFASTLQNVLIRFINPNYFSTFWNRC------------------
O61667_EGL1-01          --------------------------------------------------
Q9BXH1_BBC3-03          --------------PALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPP
F6TGJ4_BMF-01           --QILIFF------RNLVMHPVGNRAGLAQR-------------------
A0A452H3N6_BMF-01       --QILLFI------HNLALNVEVNRNHVGQR-------------------
G1PAU1_BMF-01           --QFLLFL------HNLALNGDENRNGAGPR-------------------
A2AV74_BMF-02           --QVFLFL------QNLALNRQENREGVGPW-------------------
A0A286XXB0_BMF-03       --QVLLFM------HNLGLNGEENREGAGPR-------------------
I3MDS9_BMF-02           --QILLFL------HNLALNGDENRDRAGPR-------------------
A0A287AIU8_BMF-05       --G-----------------------------------------------
A0A287AIU8_BMF-04       --QILLFL------HNLALHGDENRNGAGPR-------------------
A0A287AIU8_BMF-03       --QILLFL------HNLALHGDENRNGAGPR-------------------
A0A287AIU8_BMF-01       --QILLFL------HNLALHGDENRNGAGPR-------------------
A0A287AIU8_BMF-02       --QILLFL------HNLALHGDENRNGAGPR-------------------
A0A2K5KGR6_BMF-01       --LCLVKL------FFCCYFAF----------------------------
A0A2K6FFR1_BMF-02       --------------------------------------------------
M3WRS0_BMF-02           --------------------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
F7HPK0_BMF-02           --------------------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
G3QIN5_BMF-02           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
G7PAW6_BMF-01           --------------------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A2AV74_BMF-01           --QVFLFL------QNLALNRQENREGVGPW-------------------
Q8K589_BMF-01           --QVFLFL------QNLALNRRENREGVGPW-------------------
I3MDS9_BMF-01           --QILLFL------HNLALNGDENRDRAGPR-------------------
G3T7Z4_BMF-01           --QILQFL------HHLAVNGEENRNGAGPR-------------------
F6X3N6_BMF-01           --QILLFL------HNLALNREENRNGAGPR-------------------
G3WDQ2_BMF-01           --QILLFL------HNLALNREENRNGAGPR-------------------
Q96LC9_BMF-06           --QILLFL------HNLALNGEENRNGAGPR-------------------
F6TJI0_BMF-02           --QTLLFL------HNLALNGDENRNGAGPSFQPGQEGVLWKSAGLQLPL
F6TJI0_BMF-01           --QTLLFL------HNLALNGDENRNGAGPRCGKNVRGPVRELETSDLFL
A0A286XXB0_BMF-02       --QVLLFM------HNLGLNGEENREGAGPR-------------------
J9PB65_BMF-01           --QILLFL------HNLALNADENRNGAGPSFQLVPGISCSGAQQDCSCL
A0A286XXB0_BMF-01       --QVLLFM------HNLGLNGEENREGAGPR-------------------
G1SR62_BMF-01           --QILLFL------HNLALNGDENRDGAGPR-------------------
W5QFV1_BMF-01           --QILLFL------HNVALNGDENRNGAGPR-------------------
Q05KI3_BMF-01           --QILLFL------HNVALNGDENRNGAGPR-------------------
Q05KI3_BMF-02           --QILLFL------HNVALNGDENRNGAGPR-------------------
A0A452F2E0_BMF-02       --QILLFL------HNVALNGDENRNGAGPR-------------------
A0A452F2E0_BMF-01       --QILLFL------HNVALNGDENRNGAGPR-------------------
M3WRS0_BMF-01           --QILLFL------HNLALNAEENRNGAGPR-------------------
A0A2U4BC98_BMF-01       --QILLFL------HNLALNGDENRNGAGPR-------------------
M3YAD5_BMF-01           --QILLFL------HNLALNADENRNGAGPR-------------------
A0A452SED0_BMF-01       --QILLFL------HNLALNADENRDGAGPR-------------------
A0A384D070_BMF-01       --QILLFL------HNLALNADENRDGAGPR-------------------
A0A2K6FFR1_BMF-01       --QILLFL------HNLALNGEENRNGAGPR-------------------
H0WYH6_BMF-01           --QVLFFL------HNLALNGEENRNGAGPR-------------------
A0A096NTE9_BMF-01       --QILLFL------HNLALNGEENRNGVDPRYKNARRSVRKLKASSFLSC
A0A2K6L933_BMF-02       --QILLFL------HNLALNGEENRNGAGPRPLTWNGGRCQTLLKGRLMC
A0A096NTE9_BMF-02       --QILLFL------HNLALNGEENRNGVDPRPLTWNGAVVKPC-------
A0A2K5MJY6_BMF-02       --QILLFL------HNLALNGEENRNGAGPR-------------------
A0A2K5KGR6_BMF-02       --QILLFL------HNLALNGEENRNGAGPR-------------------
G7PAW6_BMF-02           --QILLFL------HNLALNGEENRNGAGPR-------------------
F7CM09_BMF-02           --QILLFL------HNLALNGEQNRNGAGPR-------------------
A0A2K6B5G4_BMF-01       --QILLFL------HNLALNGEENRNGAGPR-------------------
A0A2K6B5G4_BMF-02       --QILLFL------HNLALNGEENRNGAGPR-------------------
A0A2K6B5G4_BMF-04       --QILLFL------HNLALNGEENRNGAGPR-------------------
A0A2K5Z4C3_BMF-01       --QILLFL------HNLALNGEENRNGAGPR-------------------
A0A2K6L933_BMF-03       --QILLFL------HNLALNGEENRNGAGPR-------------------
A0A2K6L933_BMF-01       --QILLFL------HNLALNGEENRNGAGPR-------------------
A0A2K6RAW8_BMF-01       --QILLFL------HNLALNGEENRNGAGPR-------------------
A0A0D9R4R5_BMF-01       --QILLFL------HNLALNGEENRNGAGPR-------------------
F7HPK0_BMF-01           --QVLLFL------HNLALNGEENRNGAGPR-------------------
A0A2K5E1W9_BMF-01       --QVLLFL------HNLALNGEENRNGAGPR-------------------
A0A2K6TW86_BMF-02       --QVLLFL------HNLALNGEENRNGAGPR-------------------
A0A2K6TW86_BMF-01       --QVLLFL------HNLALNGEENRNGAGPR-------------------
G3QIN5_BMF-01           --QILLFL------HNLALNGEENRNGAGPR-------------------
Q96LC9_BMF-01           --QILLFL------HNLALNGEENRNGAGPR-------------------
Q96LC9_BMF-04           --QILLFL------HNLALNGEENRNGAGPR-------------------
Q96LC9_BMF-03           --QILLFL------HNLALNGEENRNGAGPR-------------------
Q96LC9_BMF-02           --QILLFL------HNLALNGEENRNGAGPR-------------------
A0A2R9BS98_BMF-01       --QILLFL------HNLALNGEENRNGAGPR-------------------
A0A2J8QDD5_BMF-02       --QILLFL------HNLALNGEENRNGAGPR-------------------
A0A2J8T301_BMF-01       --QILLFL------HNLALNGEENRNGAGPR-------------------
H9GL49_BMF-01           --QIFFFL------HNVALNMEANRHRAGRSCTTTYFPFTEPPVCFPFSE
K7FRX2_BMF-01           --QILLFL------HNLALNVEANRNHIGQR-------------------
A9XRG9_BMF-01           --LSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ------------------
A9XRG9_BMF-02           --LSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ------------------
U3JS06_BMF-01           --QLFLFL------HNLALNTEVNRNHTGQR-------------------
H0ZMX5_BMF-01           --QLFLFL------HNLALNTEVNRNHTGQR-------------------
A9XRG9_BMF-03           --QLFLFL------HNLALNVEANRNRTGQR-------------------
A9XRG9_BMF-04           --QLFLFL------HNLALNVEANRNRTGQR-------------------
G1NHG8_BMF-01           --QLFLFL------HNLALNVEANRNRTGQR-------------------
A0A3B4UNJ0_BMF-01       --RLTMAL------FGFLFPRQALVPRLRGEQR-----------------
B2KKY9_BCL2L11-01       --NVIIGR------LVHFFLR-----------RR----------------
B8JK68_BCL2L11-01       --NDIIGR------LVHFFLR-----------RR----------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --RVATAV------LTLLFGA--------RENRR----------------
A0A3B3RH63_BMF-01       --RLVMAL------CGLLFER------RQRAEQR----------------