Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

610 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          --------------------VRLGEAPGKPLSPGCGSGQRGPGGAGSGGA
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       ------------MGRAGRGPGAAQSVQAPRRVPAFCPVAGGSERAAARFP
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
Q4KMV9_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       MFPAAAAGAARARGAARGALGCRTARGGGRAASGRLCAAPGALKASPRLC
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-03       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-02       --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-03       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A3B1JLM2_BAD-01       --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5UAU7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3B5KWG6_BMF-01       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-04       --------------------------------------------------
A0A3B3I0V9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-02       --------------------------------------------------
A0A3B3I0V9_BMF-03       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
F6RS78_BIK-01           --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
F6Z067_BAD-01           --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
F1PUF4_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
F6RS78_BIK-02           --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
F6TGJ4_BMF-01           --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
I3MDS9_BMF-02           --------------------------------------------------
A0A287AIU8_BMF-05       --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-04       --------------------------------------------------
A0A287AIU8_BMF-03       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
W5UEE7_BCL2L11-01       --------------------------------------------------
H9GL49_BMF-01           --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
A9XRG9_BMF-02           --------------------------------------------------
A9XRG9_BMF-01           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
H0ZMX5_BMF-01           --------------------------------------------------
A9XRG9_BMF-03           --------------------------------------------------
A9XRG9_BMF-04           --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A337SQV0_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5KGR6_BMF-01       --------------------------------------------------
A0A2K6FFR1_BMF-02       --------------------------------------------------
M3WRS0_BMF-02           --------------------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
F7HPK0_BMF-02           --------------------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
G3QIN5_BMF-02           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
G7PAW6_BMF-01           --------------------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A2AV74_BMF-01           -------------------------MPGAGVFWKQYRAVCRGLLPRQLAP
Q8K589_BMF-01           --------------------------------------------------
I3MDS9_BMF-01           -------------------------MPRAGVFWKQYRAVRSGLLRRPPES
G3T7Z4_BMF-01           -------------------------MPRAGVFWKQYRTVLSLVHQRPPAL
F6X3N6_BMF-01           --------------------------------------------------
G3WDQ2_BMF-01           --------------------------------------------------
Q96LC9_BMF-06           --------------------------------------------------
F6TJI0_BMF-02           --------------------------------------------------
F6TJI0_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
J9PB65_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
M3WRS0_BMF-01           --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
A0A2U4BC98_BMF-01       --------------------------------------------------
A0A2K6FFR1_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A2K5MJY6_BMF-02       --------------------------------------------------
A0A2K5KGR6_BMF-02       --------------------------------------------------
G7PAW6_BMF-02           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5G4_BMF-04       --------------------------------------------------
A0A2K6B5G4_BMF-02       --------------------------------------------------
A0A2K6B5G4_BMF-01       --------------------------------------------------
A0A2K5Z4C3_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
F7HPK0_BMF-01           --------------------------------------------------
A0A2K5E1W9_BMF-01       --------------------------------------------------
A0A2K6TW86_BMF-02       --------------------------------------------------
A0A2K6TW86_BMF-01       --------------------------------------------------
G3QIN5_BMF-01           --------------------------------------------------
Q96LC9_BMF-02           --------------------------------------------------
Q96LC9_BMF-01           --------------------------------------------------
Q96LC9_BMF-04           --------------------------------------------------
Q96LC9_BMF-03           --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A1W4YVX7_BAD-01       --------------------------------------------------
A0A1W4YVX7_BAD-02       --------------------------------------------------
A0A3B5K831_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A2D0SYM2_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
G1SS60_BAD-01           --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A337SAW2_BAD-01       MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGR
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z697_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0C1_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2I3MCN5_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-02       --------------------------------------------------
F7GVS7_BAD-02           --------------------------------------------------
A0A2K6E7J3_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-03       --------------------------------------------------
A0A2K5HKW9_BAD-02       --------------------------------------------------
A0A2K6N1A1_BAD-02       --------------------------------------------------
A0A2K6PUM5_BAD-02       --------------------------------------------------
A0A2K5M0C1_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-03       --------------------------------------------------
F7GVS7_BAD-03           --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2I3MCN5_BAD-02       --------------------------------------------------
A0A2K6E7J3_BAD-03       --------------------------------------------------
A0A2I2Z8C7_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z697_BAD-03       --------------------------------------------------
F6SJL0_BAD-02           --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3VRY4_BAD-02           --------------------------------------------------
G3VRY4_BAD-01           --------------------------------------------------
I3MBM5_BAD-02           --------------------------------------------------
I3MBM5_BAD-01           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
Q61337_BAD-02           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
O35147_BAD-01           --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A2K5E6K7_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5M0C1_BAD-01       --------------------------------------------------
A0A2K5VCD8_BAD-01       --------------------------------------------------
F7GVS7_BAD-01           --------------------------------------------------
A0A2K6E7J3_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2I3MCN5_BAD-04       --------------------------------------------------
A0A2K6N1A1_BAD-01       --------------------------------------------------
A0A2K6PUM5_BAD-01       --------------------------------------------------
A0A2K5HKW9_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F6SJL0_BAD-01           --------------------------------------------------
A0A2I3MCN5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z697_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
                                                                          

A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      ----------------------------------------------LSKE
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          GRGGGSRSRRRSLSSPALASPNCLGADGCRRAGAGGGSGAGRSVTSRGSR
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A2K5F6X4_BBC3-02      ------------------------------------------KCGVGSAW
A0A337SQV0_BBC3-03      -----------------------------------------YLGGGGLGE
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------MKFGMGSAQACPCQVPRAASTTWV
B2KKY9_BCL2L11-01       ---------------------------------MSDTSREQTLANGPASQ
B8JK68_BCL2L11-01       ---------------------------------MSDTSREQTLANGPASQ
A0A3B3QC78_BCL2L11      --------------------------------------MGQILLTIPCSV
A0A2K6KS56_BBC3-02      ------------------------------------------LAERTWSR
F7G1G0_HRK-01           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           ------------------------------------------MEEEPSPF
Q2PG01_BAD-01           ------------------------------------------MEEEPSPF
A0A2I3H4B2_BAD-01       ------------------------------------------MGEEPSPF
K7GA86_BCL2L11-01       APAGADSERRGLAEELLLEPDSLLFRQSLSASYSLDAGKGDQMAKQPSDL
G3SU55_BCL2L11-01       ------------------------------------------MAKQPSDV
G3W979_BCL2L11-01       ------------------------------------------MAKQPSDL
Q4KMV9_BCL2L11-01       ------------------------------------------MAKQPSVL
F7FTC8_BCL2L11-01       ------------------------------------------MAKQPSDL
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
M3YDI3_BCL2L11-01       LPRFFRAEGQGAPGRRRTRAGRRGARARTRRSEGKGRTKKDQMAKQPSDV
F6XMC1_BCL2L11-02       ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-01       ------------------------------------------MAKQPSDV
F7CXT2_BCL2L11-01       ------------------------------------------MAKQPSDL
O54918_BCL2L11-01       ------------------------------------------MAKQPSDV
O88498_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-22       ------------------------------------------MAKQPSDV
O43521_BCL2L11-08       ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-06       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-04       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-24       ------------------------------------------MAKQPSDV
O43521_BCL2L11-12       ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-06       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-21       ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-08       ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A287DFJ0_BCL2L11      ------------------------------------------MAKQPSDV
A0A286XJN2_BCL2L11      ------------------------------------------MAKQPSDV
A0A286XJN2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-07       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-05       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-16       ------------------------------------------MAKQPSDV
O43521_BCL2L11-09       ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-04       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-18       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
F1SU81_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
Q2YDF0_BCL2L11-02       ------------------------------------------MAKQPSDV
W5PY58_BCL2L11-01       ------------------------------------------MAKQPSDV
G1SSY0_BCL2L11-01       ------------------------------------------MAKQPSDV
H0XW23_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
G1LDR8_BCL2L11-01       ------------------------------------------MAKQPSDV
J9NWV6_BCL2L11-01       ------------------------------------------MAKQPSDV
F1SU81_BCL2L11-01       ------------------------------------------MAKQPSDV
O43521_BCL2L11-11       ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-08       ------------------------------------------MAKQPSDV
O54918_BCL2L11-08       ------------------------------------------MAKQPSDV
O54918_BCL2L11-06       ------------------------------------------MAKQPSDV
O54918_BCL2L11-03       ------------------------------------------MAKQPSDV
O43521_BCL2L11-07       ------------------------------------------MAKQPSDV
O43521_BCL2L11-19       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-23       ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-07       ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
C1KGB8_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-10       ------------------------------------------MAKQPSDV
O43521_BCL2L11-20       ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-17       ------------------------------------------MAKQPSDV
O43521_BCL2L11-13       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-05       ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-09       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-09       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-06       ------------------------------------------MAKQPSDV
O43521_BCL2L11-15       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
F1SU81_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A0D9RWE0_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-05       ------------------------------------------MAKQPSDV
O43521_BCL2L11-25       ------------------------------------------MAKQPSDV
O54918_BCL2L11-05       ------------------------------------------MAKQPSDV
O88498_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A286XJN2_BCL2L11      ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
H2P5E2_BCL2L11-01       ------------------------------------------MAKQPSDV
Q2YDF0_BCL2L11-01       ----------MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDV
Q2YDF0_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A287DFJ0_BCL2L11      ------------------------------------------MAKQPSDV
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A3B1JLM2_BAD-01       ------------------------------------------------MS
A0A3B4UNJ0_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5UAU7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3B5KWG6_BMF-01       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-04       --------------------------------------------------
A0A3B3I0V9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-02       --------------------------------------------------
A0A3B3I0V9_BMF-03       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
F6RS78_BIK-01           --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
F6Z067_BAD-01           --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
F1PUF4_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
F6RS78_BIK-02           --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      -----------------------------------------------LLS
F6TGJ4_BMF-01           --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
I3MDS9_BMF-02           --------------------------------------------------
A0A287AIU8_BMF-05       --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-04       --------------------------------------------------
A0A287AIU8_BMF-03       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
W5UEE7_BCL2L11-01       -----------------------------------------------MLF
H9GL49_BMF-01           --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
A9XRG9_BMF-02           --------------------------------------------------
A9XRG9_BMF-01           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
H0ZMX5_BMF-01           --------------------------------------------------
A9XRG9_BMF-03           --------------------------------------------------
A9XRG9_BMF-04           --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A337SQV0_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5KGR6_BMF-01       --------------------------------------------------
A0A2K6FFR1_BMF-02       --------------------------------------------------
M3WRS0_BMF-02           --------------------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
F7HPK0_BMF-02           --------------------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
G3QIN5_BMF-02           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
G7PAW6_BMF-01           --------------------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A2AV74_BMF-01           AAVAAAARATASHRSPLEFAPFFPIECGHQAPRVFFTLDPGAEPWHHNSE
Q8K589_BMF-01           --------------------------------------------------
I3MDS9_BMF-01           AAAAGPASGSRLP------------GSGVSLPQVFITLDPGAEPWHHDSE
G3T7Z4_BMF-01           AAAA--VRSPRLPPLPAELFPSFPIESGRQAPRVLVTLDPGAEPWRHDPE
F6X3N6_BMF-01           --------------------------------------------------
G3WDQ2_BMF-01           --------------------------------------------------
Q96LC9_BMF-06           --------------------------------------------------
F6TJI0_BMF-02           --------------------------------------------------
F6TJI0_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-02       ---------MPGAGVFWKQYRARRRRRGPDPPRVFVTLDPGTEPWHHDSE
J9PB65_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
M3WRS0_BMF-01           --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
A0A2U4BC98_BMF-01       --------------------------------------------------
A0A2K6FFR1_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A2K5MJY6_BMF-02       --------------------------------------------------
A0A2K5KGR6_BMF-02       --------------------------------------------------
G7PAW6_BMF-02           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5G4_BMF-04       --------------------------------------------------
A0A2K6B5G4_BMF-02       --------------------------------------------------
A0A2K6B5G4_BMF-01       --------------------------------------------------
A0A2K5Z4C3_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
F7HPK0_BMF-01           --------------------------------------------------
A0A2K5E1W9_BMF-01       --------------------------------------------------
A0A2K6TW86_BMF-02       --------------------------------------------------
A0A2K6TW86_BMF-01       --------------------------------------------------
G3QIN5_BMF-01           --------------------------------------------------
Q96LC9_BMF-02           --------------------------------------------------
Q96LC9_BMF-01           --------------------------------------------------
Q96LC9_BMF-04           --------------------------------------------------
Q96LC9_BMF-03           --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
Q9GL49_PMAIP1-01        ------------------------------------------------MR
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------MSTAARAAAGTCDSTAVSQPSKLD
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
A0A3B3QX41_BAD-01       -----------------------------------------------MSG
A0A1W4YVX7_BAD-01       --------------------------------------------------
A0A1W4YVX7_BAD-02       ------------------------------MSKKTRNKALEGGVRKDAAD
A0A3B5K831_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A2D0SYM2_BAD-01       ------------------------------------------------MS
A0A3B4DUY7_BAD-01       ------------------------------------------------MS
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
G1SS60_BAD-01           --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------MARAQQDGSSPEPVEGLP
A0A337SAW2_BAD-01       KRPRPLASPGDISKADWAGSVTVPVAQATRAGLPQYWREAAGPGQGPRDR
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z697_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0C1_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2I3MCN5_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-02       --------------------------------------------------
F7GVS7_BAD-02           --------------------------------------------------
A0A2K6E7J3_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-03       --------------------------------------------------
A0A2K5HKW9_BAD-02       --------------------------------------------------
A0A2K6N1A1_BAD-02       --------------------------------------------------
A0A2K6PUM5_BAD-02       --------------------------------------------------
A0A2K5M0C1_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-03       --------------------------------------------------
F7GVS7_BAD-03           --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2I3MCN5_BAD-02       --------------------------------------------------
A0A2K6E7J3_BAD-03       --------------------------------------------------
A0A2I2Z8C7_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z697_BAD-03       --------------------------------------------------
F6SJL0_BAD-02           --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------QGPRYR
G3VRY4_BAD-02           --------------------------------------------------
G3VRY4_BAD-01           --------------------------------------------------
I3MBM5_BAD-02           ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
I3MBM5_BAD-01           ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
Q61337_BAD-03           --------------------------------------------------
Q61337_BAD-01           ---------MGTPKQPSLAPAHALGLRKS---DPGIRSLGSDAGGRRWRP
Q61337_BAD-02           ---------MGTPKQPSLAPAHALGLRKS---DPGIRSLGSDAGGRRWRP
G3TP47_BAD-01           ----------------GPPENPSPASTHAQGVRMSGAEHPEKKKGRRRSS
F7DN67_BAD-01           ---------MGTPENPSPAPTHAQGTRKSTAEHPETRRGPRKEGGGRRAG
G1MI17_BAD-01           -------------VGTPENPSSAPTHGPGKRKSGTDRRETRKGPRTTALA
A0A287AEF3_BAD-01       -----------MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSG
O35147_BAD-01           -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
M3YNE7_BAD-01           --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A2K5E6K7_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5M0C1_BAD-01       --------------------------------------------------
A0A2K5VCD8_BAD-01       --------------------------------------------------
F7GVS7_BAD-01           --------------------------------------------------
A0A2K6E7J3_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2I3MCN5_BAD-04       --------------------------------------------------
A0A2K6N1A1_BAD-01       --------------------------------------------------
A0A2K6PUM5_BAD-01       --------------------------------------------------
A0A2K5HKW9_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F6SJL0_BAD-01           --------------------------------------------------
A0A2I3MCN5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z697_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
F1PK10_BAD-01           ---------------TPENPSSAPAQDPGTRKSGTERREKSCALTTCCLA
Q45KI9_BAD-01           --------------------------------------------------
                                                                          

A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A2I3HX97_PMAIP1-      ------------KPGR----------------------------------
A0A1D5PAR2_PMAIP1-      -----------MMPGRT---------------------------------
A0A2K6EM90_PMAIP1-      ------------MPVKK---------------------------------
G1P8F9_PMAIP1-01        ------------MPGKK---------------------------------
G3T0P7_PMAIP1-01        ------------MPGKK---------------------------------
Q1PCT2_PMAIP1-01        ------------MPGRK---------------------------------
G1LIZ7_PMAIP1-01        ------------MPGKK---------------------------------
A0A2K5NJZ2_PMAIP1-      ------------MPGKK---------------------------------
A0A0D9S003_PMAIP1-      ------------MPGKK---------------------------------
A0A2K5VPX2_PMAIP1-      ------------MPGKK---------------------------------
A0A2K6BV75_PMAIP1-      ------------MPGKK---------------------------------
A0A2K5ZWH1_PMAIP1-      ------------MPGKK---------------------------------
A0A096MPU8_PMAIP1-      ------------MPGKK---------------------------------
A0A2K5JY52_PMAIP1-      ------------MPGKK---------------------------------
A0A2K6KJF2_PMAIP1-      ------------MPGKK---------------------------------
A0A2K6NC45_PMAIP1-      ------------MPGKK---------------------------------
A0A2K6S6C4_PMAIP1-      ------------MPGKK---------------------------------
A0A2I2YVQ5_PMAIP1-      ------------MPGKK---------------------------------
Q13794_PMAIP1-01        ------------MPGKK---------------------------------
A0A2R9AKC9_PMAIP1-      ------------MPGKK---------------------------------
A0A2I3SX38_PMAIP1-      ------------MPGKK---------------------------------
H2NWG2_PMAIP1-01        ------------MPGKK---------------------------------
A0A2K5CFK7_PMAIP1-      ------------MPGKK---------------------------------
F7GW45_PMAIP1-01        ------------MPGKK---------------------------------
A0A337SUX1_PMAIP1-      ------------MPGKR---------------------------------
W5P738_PMAIP1-01        ------------MPGRR---------------------------------
A0A287AZR7_PMAIP1-      TFMAKGKVLFASMPHRS---------------------------------
G1MV54_BCL2L11-01       ---------------FL---------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          GARLQREAAAAAAAAEPAWEPAAQDTCVRPAGATAGAGAGAVASGGGDRG
A9XRH0_BMF-01           --------------MDRPSYLEEDYSSLDGLDDD----------------
R4G9R5_BCL2L11-01       ------------------------MLVVGSSQPQLCLLPKQLNVLSANAF
A3KND0_BMF-01           -----------MDELDDDVFYPD---------------------------
Q6P7C5_BAD-01           -----------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPA
A0A287AEF3_BAD-02       --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
O61667_EGL1-01          --------------------------------------------MLMLTF
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A2K5F6X4_BBC3-02      ACPCQVPRASSSTWVPCQMCGPQPSLS-----------------------
A0A337SQV0_BBC3-03      SCVCARARCVGVTPWVCVAC-PQPSLS-----------------------
Q9JM54_PMAIP1-01        ------------MPGRK---------------------------------
Q5U777_PMAIP1-01        ------------MPGRK---------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          PCQICETRGAAAAPPLTLEGPVQSHH------------------------
B2KKY9_BCL2L11-01       GSGEST-GGGVVLPAGH---FDFPQPG-----------------------
B8JK68_BCL2L11-01       GSGEST-GGGVVLPAGH---FDFPQPG-----------------------
A0A3B3QC78_BCL2L11      CSAEDK-ITRMAESRNPVAEQTPIQAGPRTAK------------------
A0A2K6KS56_BBC3-02      GASPGALAAPGVAGRRR------SGPG-----------------------
F7G1G0_HRK-01           --MCPC-------PLHRGRGPPAVCAC-----------------------
P62816_HRK-03           --MCPC-------PRHRGRGPPAVCGC-----------------------
P62817_HRK-01           --MCPC-------PRHRGRGPPAVCGC-----------------------
A0A287A5N9_HRK-01       --MCPC-------PLHRGRGPPAVCAC-----------------------
H2NIS8_HRK-01           --MCPC-------PLHRDRGPPAVCAC-----------------------
A0A2K5KZ69_HRK-01       --MCPC-------PLHRGRGPPAVCDC-----------------------
H2Q6Y8_HRK-01           --MCPC-------PLHRGRDPPAVCAC-----------------------
G3UH24_HRK-01           --MCPC-------PLHRGRGPPAVCAC-----------------------
A0A2K5BYA0_HRK-01       --MCPC-------PLHRGRGPPAVCAC-----------------------
U3E722_HRK-01           --MCPC-------PLHRGRGPPAVCAC-----------------------
A0A0D9SC73_HRK-01       --MCPC-------PLHRGRGPPAVCAC-----------------------
A0A337SQ56_HRK-01       --MCPC-------PLHRGRGPPAVCAC-----------------------
G3QTJ6_HRK-01           --MCPC-------PLHRGRGPPAVCAC-----------------------
O00198_HRK-01           --MCPC-------PLHRGRGPPAVCAC-----------------------
A0A1D5R1E4_HRK-01       --MCPC-------PLHRGRGPPAVCAC-----------------------
A0A2K6AYL7_HRK-01       --MCPC-------PLHRGRGPPAVCAC-----------------------
G1QHD8_HRK-01           --MCPC-------PLHRGRGPPAVCAC-----------------------
G1T7W1_HRK-01           --MCPC-------PLHRGRGPPAVCAC-----------------------
H0Y001_HRK-01           --MCPC-------PLHRGRGPPAVCAC-----------------------
A0A096N944_HRK-01       --MCPC-------PLHRGRGPPAVCAC-----------------------
A0A2K6GL98_HRK-01       --MCPC-------PLHRGRGPPAVCAC-----------------------
E2RLD4_HRK-01           --MCPC-------PLHRGRGPPAVCAC-----------------------
F7GVS7_BAD-04           RGRSRS-APPNLWAAQR--YGRELRRM-----------------------
Q2PG01_BAD-01           RGRSRS-APPNLWAAQR--YGRELRRM-----------------------
A0A2I3H4B2_BAD-01       RGRSRS-APPNLWAAQR--YGRELRRM-----------------------
K7GA86_BCL2L11-01       NSECDG-EGGQFQSIERPSQPQHLRPG-----------------------
G3SU55_BCL2L11-01       SSECDR-EGGQLQPAERPPQPPQLRPG-----------------------
G3W979_BCL2L11-01       NSECDR-EGGQLQPTERPTQ-PQLRPG-----------------------
Q4KMV9_BCL2L11-01       SPDCNSGEGGQLQSTSRQHSHRPLRRG-----------------------
F7FTC8_BCL2L11-01       NSECDS-EGGRLEPAEGPAQPPQLRPG-----------------------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
M3YDI3_BCL2L11-01       SSECDR-EGGQLQPVER---PPQLRPG-----------------------
F6XMC1_BCL2L11-02       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F6XMC1_BCL2L11-01       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F7CXT2_BCL2L11-01       NSECDR-EGGQLQPTERPTQPQQLRPG-----------------------
O54918_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
O88498_BCL2L11-01       NSECDR-EGGQLQPAER---PPQLRPG-----------------------
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----------------------
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----------------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-22       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-08       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F7HHA9_BCL2L11-03       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F6XMC1_BCL2L11-06       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F6XMC1_BCL2L11-04       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-24       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-12       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F7HHA9_BCL2L11-06       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-21       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F7HHA9_BCL2L11-01       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPG-----------------------
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPG-----------------------
F6XMC1_BCL2L11-08       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPG-----------------------
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPG-----------------------
A0A287DFJ0_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----------------------
A0A286XJN2_BCL2L11      SCECDR-EGGQLQPAER---PSQLRAG-----------------------
A0A286XJN2_BCL2L11      SCECDR-EGGQLQPAER---PSQLRAG-----------------------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F6XMC1_BCL2L11-07       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F6XMC1_BCL2L11-05       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F7HHA9_BCL2L11-02       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-16       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-09       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F7HHA9_BCL2L11-04       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-18       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F6XMC1_BCL2L11-03       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-03       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F1SU81_BCL2L11-02       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----------------------
Q2YDF0_BCL2L11-02       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
W5PY58_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
G1SSY0_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
H0XW23_BCL2L11-01       GSECDR-EGGQLQPAER---PPQLRPG-----------------------
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----------------------
G1LDR8_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
J9NWV6_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
F1SU81_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-11       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F7HHA9_BCL2L11-08       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O54918_BCL2L11-08       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
O54918_BCL2L11-06       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
O54918_BCL2L11-03       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-07       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-19       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-23       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F7HHA9_BCL2L11-07       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
C1KGB8_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPG-----------------------
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-10       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-20       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-17       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-13       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F7HHA9_BCL2L11-05       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F6XMC1_BCL2L11-09       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F7HHA9_BCL2L11-09       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-06       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-15       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
F1SU81_BCL2L11-03       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
A0A0D9RWE0_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-05       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-25       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O54918_BCL2L11-05       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
O88498_BCL2L11-02       NSECDR-EGGQLQPAER---PPQLRPG-----------------------
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPG-----------------------
A0A286XJN2_BCL2L11      SCECDR-EGGQLQPAER---PSQLRAG-----------------------
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----------------------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
O43521_BCL2L11-02       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----------------------
H2P5E2_BCL2L11-01       SSECDR-EGRQLQPAER---PPQLRPG-----------------------
Q2YDF0_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
Q2YDF0_BCL2L11-03       SSECDR-EGGQLQPAER---PPQLRPG-----------------------
A0A287DFJ0_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A3B1JLM2_BAD-01       NQYLLKLRRARFNCDEEGYSQALNSRTSTEGGGRDTLFRPLCWNSSGSTV
A0A3B4UNJ0_BMF-01       -------------------------MDDEEEDMSQPI--SHLWGTSFRDV
Q0GKC7_BMF-01           -------------------------MDEDEDDVFRKG--LQHWPPPHLQI
W5N4P7_BMF-01           -------------------------MEEDEDDVFHPSHFSHCWGTQFREI
A0A3B3RH63_BMF-01       -------------------------MDDDDDDVFHTD--PLTYQPPFRDI
W5UAU7_BMF-01           -------------------------MDEDEDEVFGPI--SQCWPSSNREI
A0A3B1K1X5_BMF-01       -------------------------MDDEEDDVFVTD--PEPWRSPISVI
A0A3B4CNJ8_BMF-01       -------------------------MDEDEDDVFVMD--TQYWRSSIREI
A0A2U9CJH3_BMF-01       -------------------------MDDEEDDVFEPD--PHCWRTTFREI
A0A3B5KWG6_BMF-01       -------------------------MDDEEDDVFQPD--PYSWRTTFQEI
A0A3B3CGR9_BMF-01       -------------------------MDDEEDDVFEPD--PNNWRTAVRKI
A0A3B3I0V9_BMF-04       -------------------------MDDEEDDVFEPD--PNKWRTTARKI
A0A3B3I0V9_BMF-01       -------------------------MDDEEDDVFEPD--PNKWRTTARKI
A0A3B3I0V9_BMF-02       -------------------------MDDEEDDVFEPD--PNKWRTTARKI
A0A3B3I0V9_BMF-03       -------------------------MDDEEDDVFEPD--PNKWRTTARKI
A0A3B4U5H8_BMF-01       -------------------------MDDEEDDVFEPD--PHCWRTTFREI
A0A3B4WM88_BMF-01       -------------------------MDDEEDDVFEPD--PHCWRTTFREI
I3K2D6_BMF-01           -------------------------MDDEEDDVFEPK--ANCWRTTFREI
A0A3B4ETH0_BMF-01       -------------------------MDDEEDDVFEPK--ANCWRTTFREI
A0A3B5B8F6_BMF-01       -------------------------MDDEEDDVFEPD--PHCWRTTFREI
A0A096LRV0_BMF-01       -------------------------MEDEEDDVFEPD--PNCWRTPFREI
A0A3B3WU80_BMF-01       -------------------------MEDEEDDVFEPD--PNCWRTPFREI
A0A3B5QK08_BMF-02       -------------------------MEDEEDDVFEPD--PNCWRTPFREI
A0A3B5QK08_BMF-01       -------------------------MEDEEDDVFEPD--PNCWRTPFREI
F6RS78_BIK-01           -------------------------------------------MSQVGPV
A0A2K5JY52_PMAIP1-      ------------------------------------------------MP
A0A096MPU8_PMAIP1-      ------------------------------------------------MP
A0A2K5ZWH1_PMAIP1-      ------------------------------------------------MP
A0A2K5VPX2_PMAIP1-      ------------------------------------------------MP
A0A2K6BV75_PMAIP1-      ------------------------------------------------MP
A0A2K6KJF2_PMAIP1-      ------------------------------------------------MP
A0A2K6NC45_PMAIP1-      ------------------------------------------------MP
Q13794_PMAIP1-02        ------------------------------------------------MP
A0A2R9AKC9_PMAIP1-      ------------------------------------------------MP
A0A1D5QGJ8_PMAIP1-      ------------------------------------------------MP
A0A2I2YVQ5_PMAIP1-      ------------------------------------------------MP
A0A2I3SX38_PMAIP1-      ------------------------------------------------MP
C1C3S9_BAD-01           --------------------------------------------------
A0A3B4CPH6_BAD-01       -----------MAHMFTLSDDSDTSEDLGDADQPEASKRAELSQSGQHPL
F6Z067_BAD-01           -------------------------------------------MADSSPS
M3XHJ5_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           -------------------------------------------MYQARPL
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           -------------------------------------------MSEARLM
O70337_BIK-01           -------------------------------------------MSEARLM
Q925D2_BIK-01           -------------------------------------------MSEARLM
G1TZR9_BIK-01           -------------------------------------------MSEVRPG
H0W025_BIK-01           -------------------------------------------MSEAKPV
A0A2K5CLG5_BIK-01       -------------------------------------------MSEVRPL
F7FUT7_BIK-01           -------------------------------------------MSEVRPL
A0A2K6TBD7_BIK-01       -------------------------------------------MSEDRPL
H2P4N6_BIK-01           -------------------------------------------MSEVRPI
G1S1X2_BIK-01           -------------------------------------------MSEVRPI
G3QCT2_BIK-01           -------------------------------------------MSEVRPL
A0A2R8ZXD2_BIK-01       -------------------------------------------MSEVRPL
H2QLU7_BIK-01           -------------------------------------------MSEVRPL
Q13323_BIK-01           -------------------------------------------MSEVRPL
A0A2K6MCW0_BIK-01       -------------------------------------------MSGVRPV
A0A2K6QK74_BIK-01       -------------------------------------------MSGVRPV
A0A0D9QZY8_BIK-01       -------------------------------------------MSGVRPI
A0A2K5VW94_BIK-01       -------------------------------------------MSGVRPI
A0A2K6DBJ4_BIK-01       -------------------------------------------MSGVRPI
A0A2K5J4Q7_BIK-01       -------------------------------------------MSGVRPI
A0A096NKG5_BIK-01       -------------------------------------------MSGVRPI
A0A2K5LDM6_BIK-01       -------------------------------------------MSGVRPI
A0A2K5XSA1_BIK-01       -------------------------------------------MSGVRPI
F1PUF4_BIK-01           -------------------------------------------MSHSGPL
H0XAE7_BIK-01           -------------------------------------------MSAGRPV
A0A2K6FM79_BIK-01       -------------------------------------------MSEVRPV
F6RS78_BIK-02           ---MRKRRRHAAAKRQTWDS------------------------------
A0A3B1JXK6_BCL2L11      ----------------------MSRPSN----------------------
A0A3B4BVX1_BCL2L11      ARKARFSVCPCSSPEDRIHHLPHYLRSN----------------------
F6TGJ4_BMF-01           -----------QESYLNMDE-------L----------------------
G1PAU1_BMF-01           -----------MEPPQCVEE-------L----------------------
A2AV74_BMF-02           ------MSPGEMEPPQCVEE-------L----------------------
A0A286XXB0_BMF-03       ------VFPREMEPPQCVEE-------L----------------------
I3MDS9_BMF-02           ------VFPEEMEPPQCVEE-------L----------------------
A0A287AIU8_BMF-05       -----------MEPPQCVEE-------L----------------------
A0A287AIU8_BMF-01       -----------MEPPQCVEE-------L----------------------
A0A287AIU8_BMF-04       -----------MEPPQCVEE-------L----------------------
A0A287AIU8_BMF-03       -----------MEPPQCVEE-------L----------------------
A0A287AIU8_BMF-02       -----------MEPPQCVEE-------L----------------------
W5UEE7_BCL2L11-01       ARRRRFFFCPWSPEAVCPRNMSKRQYRA----------------------
H9GL49_BMF-01           -----------MDPPGYLDDDFSTLDGL----------------------
K7FRX2_BMF-01           -----------MDPPSYLEEDYSSLDGL----------------------
A9XRG9_BMF-02           -----------MDRPSYLEEDYSSLDGL----------------------
A9XRG9_BMF-01           -----------MDRPSYLEEDYSSLDGL----------------------
U3JS06_BMF-01           -----------MDRPSYLEEDYSSLDGL----------------------
H0ZMX5_BMF-01           -----------MDRPSYLEEDYSSLDGL----------------------
A9XRG9_BMF-03           -----------MDRPSYLEEDYSSLDGL----------------------
A9XRG9_BMF-04           -----------MDRPSYLEEDYSSLDGL----------------------
G1NHG8_BMF-01           -----------MDRPSYLEEDYSSLDGL----------------------
A0A3B4V919_BCL2L11      ------MKAQADGAALFIQQ-------T----------------------
A0A3B4XZH1_BCL2L11      ------MKAQADGAALFIQQ-------T----------------------
A0A337SQV0_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5KGR6_BMF-01       -----------MEPSRCVEE-------L----------------------
A0A2K6FFR1_BMF-02       -----------MEPSHCVEE-------L----------------------
M3WRS0_BMF-02           -----------MEPPQCVEE-------L----------------------
A0A2K5E1W9_BMF-02       -----------MEPSQCVEE-------L----------------------
F7HPK0_BMF-02           -----------MEPSQCVEE-------L----------------------
A0A2K6TW86_BMF-03       -----------MEPSQCVEE-------L----------------------
A0A2K6RAW8_BMF-02       -----------MEPSRCVEE-------L----------------------
G3QIN5_BMF-02           -----------MEPSQCVEE-------L----------------------
Q96LC9_BMF-07           -----------MEPSQCVEE-------L----------------------
Q96LC9_BMF-05           -----------MEPSQCVEE-------L----------------------
A0A2R9BS98_BMF-02       -----------MEPSQCVEE-------L----------------------
A0A2J8QDD5_BMF-01       -----------MEPSQCVEE-------L----------------------
A0A2K5MJY6_BMF-01       -----------MEPSRCVEE-------L----------------------
G7PAW6_BMF-01           -----------MEPSRCVEE-------L----------------------
A0A2K6B5G4_BMF-03       -----------MEPSRCVEE-------L----------------------
A0A2K5Z4C3_BMF-02       -----------MEPSRCVEE-------L----------------------
A0A096NTE9_BMF-03       -----------MEPSRCVEE-------L----------------------
A0A2I3HD83_BMF-01       -----------MEPSQCVEE-------L----------------------
A2AV74_BMF-01           AETLSWSHPGEMEPPQCVEE-------L----------------------
Q8K589_BMF-01           -----------MEPPQCVEE-------L----------------------
I3MDS9_BMF-01           AETLSWSHPGEMEPPQCVEE-------L----------------------
G3T7Z4_BMF-01           TDTLSWSHPGEMEPSQCVEE-------L----------------------
F6X3N6_BMF-01           -----------MEPPHYVEE-------L----------------------
G3WDQ2_BMF-01           -----------MESPHYVEE-------L----------------------
Q96LC9_BMF-06           -----------MEPSQCVEE-------L----------------------
F6TJI0_BMF-02           -----------MEPPQCVEE-------L----------------------
F6TJI0_BMF-01           -----------MEPPQCVEE-------L----------------------
A0A286XXB0_BMF-02       ADSLSWSHPGEMEPPQCVEE-------L----------------------
J9PB65_BMF-01           -----------MEPPQCVEE-------L----------------------
A0A286XXB0_BMF-01       -----------MEPPQCVEE-------L----------------------
G1SR62_BMF-01           -----------MEPPQCVEE-------L----------------------
Q05KI3_BMF-02           -----------MEPPQCVEE-------L----------------------
Q05KI3_BMF-01           -----------MEPPQCVEE-------L----------------------
W5QFV1_BMF-01           -------LTGEMEPPQCVEE-------L----------------------
M3WRS0_BMF-01           -----------MEPPQCVEE-------L----------------------
M3YAD5_BMF-01           -----------MEPPQCVEE-------L----------------------
A0A2U4BC98_BMF-01       -----------MEPPQCVEE-------L----------------------
A0A2K6FFR1_BMF-01       -----------MEPSHCVEE-------L----------------------
H0WYH6_BMF-01           -----------MEPSQCVEE-------L----------------------
A0A096NTE9_BMF-01       -----------MEPSRCVEE-------L----------------------
A0A2K6L933_BMF-02       -----------MEPSRCVEE-------L----------------------
A0A096NTE9_BMF-02       -----------MEPSRCVEE-------L----------------------
A0A2K5MJY6_BMF-02       -----------MEPSRCVEE-------L----------------------
A0A2K5KGR6_BMF-02       -----------MEPSRCVEE-------L----------------------
G7PAW6_BMF-02           -----------MEPSRCVEE-------L----------------------
F7CM09_BMF-02           -----------MEPSRCVEE-------L----------------------
A0A2K6B5G4_BMF-04       -----------MEPSRCVEE-------L----------------------
A0A2K6B5G4_BMF-02       -----------MEPSRCVEE-------L----------------------
A0A2K6B5G4_BMF-01       -----------MEPSRCVEE-------L----------------------
A0A2K5Z4C3_BMF-01       -----------MEPSRCVEE-------L----------------------
A0A2K6L933_BMF-01       -----------MEPSRCVEE-------L----------------------
A0A2K6L933_BMF-03       -----------MEPSRCVEE-------L----------------------
A0A2K6RAW8_BMF-01       -----------MEPSRCVEE-------L----------------------
A0A0D9R4R5_BMF-01       -----------MEPSRCVEE-------L----------------------
F7HPK0_BMF-01           -----------MEPSQCVEE-------L----------------------
A0A2K5E1W9_BMF-01       -----------MEPSQCVEE-------L----------------------
A0A2K6TW86_BMF-02       -----------MEPSQCVEE-------L----------------------
A0A2K6TW86_BMF-01       -----------MEPSQCVEE-------L----------------------
G3QIN5_BMF-01           -----------MEPSQCVEE-------L----------------------
Q96LC9_BMF-02           -----------MEPSQCVEE-------L----------------------
Q96LC9_BMF-01           -----------MEPSQCVEE-------L----------------------
Q96LC9_BMF-04           -----------MEPSQCVEE-------L----------------------
Q96LC9_BMF-03           -----------MEPSQCVEE-------L----------------------
A0A2R9BS98_BMF-01       -----------MEPSQCVEE-------L----------------------
A0A2J8QDD5_BMF-02       -----------MEPSQCVEE-------L----------------------
A0A2J8T301_BMF-01       -----------MEPSQCVEE-------L----------------------
A0A3B3VNE0_BCL2L11      --------MHSSRPPNLLDG-------S----------------------
A0A3B3YII5_BCL2L11      --------MHSLRPPNLLDG-------S----------------------
A0A3B3YII5_BCL2L11      --------MHSLRPPNLLDG-------S----------------------
A0A3B5M375_BCL2L11      --MLTVTLCSSNRPPNLLDG-------S----------------------
A0A3B5QAM1_BCL2L11      --MLTVTLCSSNRPPNLLDG-------S----------------------
A0A3B5QAM1_BCL2L11      --------MHSLRPPNLLDG-------S----------------------
E7FBJ6_BAD-01           -MENTSHDHQDDS------S-------T----------------------
B5XEF1_BAD-01           --MDYTHDCVDECESDHSGT-------T----------------------
Q9GL49_PMAIP1-01        SSGSLGSRIRGLLESAGWEE-------L----------------------
A0A3B4BVX1_BCL2L11      ------MQNSNYCCF--EQG-------E----------------------
A0A3B4BVX1_BCL2L11      --MSRRSNRAGRPAFLKEQG-------E----------------------
I3K7B6_BAD-01           --MAANFTI-SDSESETSEE-------V----------------------
A0A3B4GXJ6_BAD-01       --MAANFKI-SDSDSEASEE-------V----------------------
B5X1T1_BAD-01           --MDHTHDC-VDDNPETMNE-------H----------------------
H3ANP3_BAD-03           -----MFQI-SDSDSDAYED-------D----------------------
H3ANP3_BAD-01           -----MFQI-SDSDSDAYED-------D----------------------
H3ANP3_BAD-02           -----MFQI-SDSDSDAYED-------D----------------------
H3ANP3_BAD-04           -----MFQI-SDSDSDAYED-------D----------------------
H3D8J8_BAD-01           --MAAKFSLCSDSDSEPSEE-------V----------------------
A0A3B5L9R9_BAD-01       --MDTKFTI-SDGESDPSED-------V----------------------
A0A3B1IH05_BAD-01       FTMDHMFTI--SDESDASEE-------L----------------------
Q4V925_BAD-02           --MAHMFNISDDSETETMED-------S----------------------
Q4V925_BAD-03           --MAHMFNISDDSETETMED-------S----------------------
A7MCM4_BAD-01           --MAHMFNISDDSETETMED-------S----------------------
Q4V925_BAD-04           --MAHMFNISDDSETETMED-------S----------------------
Q4V925_BAD-01           --MAHMFNISDDSETETMED-------S----------------------
A0A3B3BQF7_BAD-01       --MAAKFSI-SDNDSESSEE-------V----------------------
A0A2U9BAC9_BAD-01       --MAANFTI-SDSESEPSEE-------V----------------------
A0A3B4VFC5_BAD-01       --MAANFTI-SDSESEPSEE-------V----------------------
A0A3B4W9T1_BAD-01       --MAANFTI-SDSESEPSEE-------V----------------------
A0A3B3QX41_BAD-01       VTMAHMFTI-SGNESDTSES------------------------------
A0A1W4YVX7_BAD-01       --MDRMFSI-SDNESETSD-------------------------------
A0A1W4YVX7_BAD-02       VTMDRMFSI-SDNESETSD-------------------------------
A0A3B5K831_BAD-01       --MATRFSISSDSDSDPSEE-------V----------------------
A0A087X8P8_BAD-01       --MDAKFTI-SDSDSEPSED-------V----------------------
A0A3B3UA11_BAD-01       --MDAKFTI-SDSDSEPSED-------V----------------------
A0A3B3YFR1_BAD-01       --MDAKFTI-SDSDSEPSED-------V----------------------
A0A3B5Q2N7_BAD-01       --MDTKFTI-SDGESDPSED-------V----------------------
A0A3B3HDU2_BAD-01       --MAAKFTI-SDDSESSEE--------V----------------------
G3Q8B3_BAD-01           --MAAHFTI-SDSESEPSDG-------V----------------------
A0A3B5BAL2_BAD-01       --MAAQFSI-SGSESDPEE--------V----------------------
A0A2D0SYM2_BAD-01       NQYLLRLRKARFNFDKEEYTKVINTRIGSEGGGTILNHFFGNSSRITAFT
A0A3B4DUY7_BAD-01       NQYLQKLRRARFNCEEERYKKVIKTLTGEK--GTPFNPLCWNSLRTTACA
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          -----------MARARQEGSSPEPVEGLARESPRPFPLGSLVPSAVSCGL
M3Y0R3_BBC3-01          -----QAPGSAMARARQEGSSPEPVEGLSRDGPRPFPLSRLVPSAVSCGL
Q99ML1_BBC3-02          -----------MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSL
Q80ZG6_BBC3-01          -----------MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCGL
H0XQ00_BBC3-01          -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
J9NTK9_BBC3-01          -----------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGL
A0A337SQV0_BBC3-02      -----------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGL
F1RM01_BBC3-01          -----------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGL
A0A2K6FQZ3_BBC3-01      -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
Q9BXH1_BBC3-06          -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
A0A2I3RIG5_BBC3-02      -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
H2NZD3_BBC3-01          -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
A0A2K6QZU4_BBC3-01      -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
A0A0D9S2H2_BBC3-01      -----QAPGSAMARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
B4DQK3_BBC3-01          -----MAPGSAMARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
G1SS60_BAD-01           --------------------------------------------------
K7E5Y2_BBC3-02          RESPRTFPLGRLMPSAV-SCSL----------------------------
A0A337SAW2_BAD-01       AWAQSMFQIPEFEPSEQEDSSP----------------------------
A0A2I3TBK7_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2R8Z697_BAD-02       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2I2Z8C7_BAD-03       -----MFQIPEFEPSEQEDSSS----------------------------
Q92934_BAD-03           -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K5M0C1_BAD-02       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K5XJR2_BAD-02       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2I3MCN5_BAD-03       -----MFQIPEFEPSEQEDSRS----------------------------
A0A2K5VCD8_BAD-02       -----MFQIPEFEPSEQEDSSS----------------------------
F7GVS7_BAD-02           -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K6E7J3_BAD-02       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K5E6K7_BAD-02       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K6TG62_BAD-02       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K5E6K7_BAD-03       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K5HKW9_BAD-02       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K6N1A1_BAD-02       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K6PUM5_BAD-02       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K5M0C1_BAD-03       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K5VCD8_BAD-03       -----MFQIPEFEPSEQEDSSS----------------------------
F7GVS7_BAD-03           -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K5XJR2_BAD-03       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2I3MCN5_BAD-02       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K6E7J3_BAD-03       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2I2Z8C7_BAD-04       -----MFQIPEFEPSEQEDSSS----------------------------
Q92934_BAD-04           -----MFQIPEFEPSEQEDSSS----------------------------
A0A2I3TBK7_BAD-03       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2R8Z697_BAD-03       -----MFQIPEFEPSEQEDSSS----------------------------
F6SJL0_BAD-02           -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K6TG62_BAD-03       -----MFQIPEFEPSEQEDSSS----------------------------
G1P8C5_BAD-01           PTAQSMFQIPEFEHSEQEDSSP----------------------------
W5P8G9_BAD-01           AWAQSMFQIPEFEQSEQEDSSP----------------------------
G3VRY4_BAD-02           -----MFQISEFEPSEPGEDPS----------------------------
G3VRY4_BAD-01           -----MFQISEFEPSEPGEDPS----------------------------
I3MBM5_BAD-02           AWTQSMFQIPEFEPSEQEDSSS----------------------------
I3MBM5_BAD-01           AWTQSMFQIPEFEPSEQEDSSS----------------------------
Q61337_BAD-03           -----MFQIPEFEPSEQEDASA----------------------------
Q61337_BAD-01           A-AQSMFQIPEFEPSEQEDASA----------------------------
Q61337_BAD-02           A-AQSMFQIPEFEPSEQEDASA----------------------------
G3TP47_BAD-01           GGLQSMFQIPEFEQSDREDSTP----------------------------
F7DN67_BAD-01           PAAGSMFQIPEFEQSEPEDSSP----------------------------
G1MI17_BAD-01           PTAQSMFQIPEFEPSEQEDSSP----------------------------
A0A287AEF3_BAD-01       PASQSMFQIPEFEQSEQEDSSP----------------------------
O35147_BAD-01           PAAQSMFQIPEFEPSEQEDAST----------------------------
M3YNE7_BAD-01           -----MFQIPEFEPSEQEDSSP----------------------------
F1MUT9_BAD-01           -----MFQIPEFEQSEQEDSSP----------------------------
Q3SYZ0_BAD-01           -----MFQIPEFEQSEQEDSSR----------------------------
H0WVR2_BAD-01           -----MFQIPEFEPSEQEDSSS----------------------------
H0V608_BAD-01           -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K5E6K7_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K6TG62_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
A0A0D9R491_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K5M0C1_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K5VCD8_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
F7GVS7_BAD-01           -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K6E7J3_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K5XJR2_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2I3MCN5_BAD-04       -----MFQIPEFEPSEQEDSRS----------------------------
A0A2K6N1A1_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K6PUM5_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K5HKW9_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
B4DZQ9_BAD-01           -----MFQIPEFEPSEQEDSSS----------------------------
A0A2K6GWV0_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
F6SJL0_BAD-01           -----MFQIPEFEPSEQEDSSS----------------------------
A0A2I3MCN5_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2I2Z8C7_BAD-02       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2I2Z8C7_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
Q92934_BAD-01           -----MFQIPEFEPSEQEDSSS----------------------------
Q92934_BAD-02           -----MFQIPEFEPSEQEDSSS----------------------------
A0A2I3TBK7_BAD-02       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2R8Z697_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
A0A2J8TYJ3_BAD-01       -----MFQIPEFEPSEQEDSSS----------------------------
F1PK10_BAD-01           PTAQSMFQIPEFEPSEQEDSSP----------------------------
Q45KI9_BAD-01           -----MFQIPEFEPSEQEDSSP----------------------------
                                                                          

A0A0P0HZF9_PMAIP1-      ------------MAKKEKT-------------------------------
Q0GKC8_PMAIP1-01        ------------MAKKEQT-------------------------------
A0A3B5RFA9_PMAIP1-      ----------------LPA-------------------------------
U3IW89_BCL2L11-01       ------------------S-------------------------------
Q6JTU4_BCL2L11-01       ---------MRQAEPADMR-------------------------------
A0A2I3HX97_PMAIP1-      ARRNAQPSPAPAPAELE---------------------------------
A0A1D5PAR2_PMAIP1-      IRK---PAPPAAPAERD---------------------------------
A0A2K6EM90_PMAIP1-      ARKNAQPSPTRTRAEIE---------------------------------
G1P8F9_PMAIP1-01        ARKNAQPSPTRAPAEAE---------------------------------
G3T0P7_PMAIP1-01        ARKSAQPGPAGTPAGTQQR-------------------------------
Q1PCT2_PMAIP1-01        ARKSAQPGPTRAPEELE---------------------------------
G1LIZ7_PMAIP1-01        ARKSAQASPARTRGQPE---------------------------------
A0A2K5NJZ2_PMAIP1-      ARKNAQPSPMRAQAELE---------------------------------
A0A0D9S003_PMAIP1-      ARKNAQPSPTRAQAELE---------------------------------
A0A2K5VPX2_PMAIP1-      ARKNAQPSPTRAQAELE---------------------------------
A0A2K6BV75_PMAIP1-      ARKNAQPSPTRAQAELE---------------------------------
A0A2K5ZWH1_PMAIP1-      ARKNAQPSPTRAQAELE---------------------------------
A0A096MPU8_PMAIP1-      ARKNAQPSPTRAQAELE---------------------------------
A0A2K5JY52_PMAIP1-      ARKNAQPSPARAQAELE---------------------------------
A0A2K6KJF2_PMAIP1-      ARKNAQPSPARAQAELE---------------------------------
A0A2K6NC45_PMAIP1-      ARKNAQPSPARAQAELE---------------------------------
A0A2K6S6C4_PMAIP1-      ARKSAQPSPARAPADLE---------------------------------
A0A2I2YVQ5_PMAIP1-      ARKNAQPSPARAPAELE---------------------------------
Q13794_PMAIP1-01        ARKNAQPSPARAPAELE---------------------------------
A0A2R9AKC9_PMAIP1-      ARKNAQPSPARAPAELE---------------------------------
A0A2I3SX38_PMAIP1-      ARKNAQPSPARAPAELE---------------------------------
H2NWG2_PMAIP1-01        ARKNAQPSPARAPAELE---------------------------------
A0A2K5CFK7_PMAIP1-      ARKSAQPSPSRAPADLE---------------------------------
F7GW45_PMAIP1-01        ARKSAQPSPARAPADLE---------------------------------
A0A337SUX1_PMAIP1-      TRKSAQPSPARAPAEPE---------------------------------
W5P738_PMAIP1-01        ARRSAQPSPTRVPADPE---------------------------------
A0A287AZR7_PMAIP1-      SNKNTQTNPLRLALPPL---------------------------------
G1MV54_BCL2L11-01       LCAASRWRSHSLAEEIQ---------------------------------
G1PDJ5_BCL2L11-01       ----SMQQSQALPVDMR---------------------------------
K7E5Y2_BBC3-01          GGSSSSSSSSSSSSSSRGSSRGSGGEQAARSQAPPGRPGPRLTAPQARPR
A9XRH0_BMF-01           ---VFHSDD--------FG-------------------------------
R4G9R5_BCL2L11-01       AISCFLYRDVP------WR-------------------------------
A3KND0_BMF-01           ---AFGYPDQTITSSSLFN-------------------------------
Q6P7C5_BAD-01           AQSMFQIPE--------FE-------------------------------
A0A287AEF3_BAD-02       ---MFQIPE--------FE-------------------------------
I3LVX0_BIK-01           --------------------------------------------------
O61667_EGL1-01          ASTSSDLLPMSNVFDVQSS-------------------------------
A0A286XF37_PMAIP1-      MPGKVCKSAQPNSTRAELE-------------------------------
A0A2K5F6X4_BBC3-02      LAEQHLESPVPSAPGALAG-------------------------------
A0A337SQV0_BBC3-03      PAEQHLESPVPSAPGALAG-------------------------------
Q9JM54_PMAIP1-01        ARRNAPVNPTRAELPPEFA-------------------------------
Q5U777_PMAIP1-01        ARRNAPLNPTRAELPPEFA-------------------------------
F1SMU1_PMAIP1-01        --ARAAAGAPTSEAFGRSG-------------------------------
Q9BXH1_BBC3-04          GTPALTQGPQSPRDGAQLG-------------------------------
B2KKY9_BCL2L11-01       -------------EGDPLR-------------------------------
B8JK68_BCL2L11-01       -------------EGDPLR-------------------------------
A0A3B3QC78_BCL2L11      VPGQLQATPR----------------------------------------
A0A2K6KS56_BBC3-02      IGAQLRRMARRLN-------------------------------------
F7G1G0_HRK-01           SSDRLE--------------------------------------------
P62816_HRK-03           GDARPG--------------------------------------------
P62817_HRK-01           GDARPG--------------------------------------------
A0A287A5N9_HRK-01       SASRLG--------------------------------------------
H2NIS8_HRK-01           SAGRLG--------------------------------------------
A0A2K5KZ69_HRK-01       SAGRLG--------------------------------------------
H2Q6Y8_HRK-01           SAGRLG--------------------------------------------
G3UH24_HRK-01           SAGRLG--------------------------------------------
A0A2K5BYA0_HRK-01       SAGRLG--------------------------------------------
U3E722_HRK-01           SAGRLG--------------------------------------------
A0A0D9SC73_HRK-01       SAGRLG--------------------------------------------
A0A337SQ56_HRK-01       SAGRLG--------------------------------------------
G3QTJ6_HRK-01           SAGRLG--------------------------------------------
O00198_HRK-01           SAGRLG--------------------------------------------
A0A1D5R1E4_HRK-01       SAGRLG--------------------------------------------
A0A2K6AYL7_HRK-01       SAGRLG--------------------------------------------
G1QHD8_HRK-01           SAGRLG--------------------------------------------
G1T7W1_HRK-01           SAGRLG--------------------------------------------
H0Y001_HRK-01           SAGRLG--------------------------------------------
A0A096N944_HRK-01       SAGRLG--------------------------------------------
A0A2K6GL98_HRK-01       SAGRLG--------------------------------------------
E2RLD4_HRK-01           SAGRLA--------------------------------------------
F7GVS7_BAD-04           SDEFVDS-------------------------------------------
Q2PG01_BAD-01           SDEFVDS-------------------------------------------
A0A2I3H4B2_BAD-01       SDEFVDS-------------------------------------------
K7GA86_BCL2L11-01       APTSIQTQYQ----------------------------------------
G3SU55_BCL2L11-01       APTSLLTEPQGNPDG-----------------------------------
G3W979_BCL2L11-01       APTSIQTQYQGN-SG-----------------------------------
Q4KMV9_BCL2L11-01       APTSLSSPFQ----GNQSD-------------------------------
F7FTC8_BCL2L11-01       APTSIRTQYQ----------------------------------------
A0A2K6E226_BCL2L11      APTSLQTDP-----------------------------------------
M3YDI3_BCL2L11-01       APTSLQTEQQ----------------------------------------
F6XMC1_BCL2L11-02       APTSLQTEPQ----------------------------------------
F6XMC1_BCL2L11-01       APTSLQTEPQGNPEGNHGG-------------------------------
F7CXT2_BCL2L11-01       APTSIQTQYQGNS-----G-------------------------------
O54918_BCL2L11-01       APTSLQTEPQGNPDG-----------------------------------
O88498_BCL2L11-01       APTSLQTESQGNPDG-----------------------------------
A0A337SW42_BCL2L11      APTSLQTEQQGNPE----G-------------------------------
A0A337SW42_BCL2L11      APTSLQTEQQGNPE----G-------------------------------
A0A2K5NU92_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5HZI7_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I2YQ13_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
O43521_BCL2L11-22       APTSLQTEPQGNPEGNHGG-------------------------------
O43521_BCL2L11-08       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5X2I7_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
F7HHA9_BCL2L11-03       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6E226_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5Z8B6_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I3HW02_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2R9CA99_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2J8JCT2_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I3M6I1_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6KJP8_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2K6QIL2_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2K5CAB2_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
F6XMC1_BCL2L11-06       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6TRZ5_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5CAB2_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6TRZ5_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5CAB2_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
F6XMC1_BCL2L11-04       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6TRZ5_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5NU92_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5HZI7_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I2YQ13_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
O43521_BCL2L11-24       APTSLQTEPQGNPEGNHGG-------------------------------
O43521_BCL2L11-12       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5X2I7_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
F7HHA9_BCL2L11-06       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6E226_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5Z8B6_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I3HW02_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2R9CA99_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2J8JCT2_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I3M6I1_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6KJP8_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2K6QIL2_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2K5NU92_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I2YQ13_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
O43521_BCL2L11-21       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5X2I7_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
F7HHA9_BCL2L11-01       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6E226_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5Z8B6_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I3HW02_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2R9CA99_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2J8JCT2_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I3M6I1_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6KJP8_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2K6QIL2_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2K5HZI7_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6GE31_BCL2L11      APTSLQTEPQGNPEGSREG-------------------------------
A0A2K6GE31_BCL2L11      APTSLQTEPQGNPEGSREG-------------------------------
F6XMC1_BCL2L11-08       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6GE31_BCL2L11      APTSLQTEPQGNPEGSREG-------------------------------
A0A2K6GE31_BCL2L11      APTSLQTEPQGNPEGSREG-------------------------------
A0A287DFJ0_BCL2L11      APTSLQTEPQGNPEG-----------------------------------
A0A286XJN2_BCL2L11      APTSLQTEPQGNPEG-----------------------------------
A0A286XJN2_BCL2L11      APTSLQTEPQGNPEG-----------------------------------
A0A2K5CAB2_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
F6XMC1_BCL2L11-07       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6TRZ5_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
F6XMC1_BCL2L11-05       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6TRZ5_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5CAB2_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5NU92_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5HZI7_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5X2I7_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
F7HHA9_BCL2L11-02       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6E226_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5Z8B6_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I3M6I1_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6KJP8_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2K6QIL2_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2I2YQ13_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
O43521_BCL2L11-16       APTSLQTEPQGNPEGNHGG-------------------------------
O43521_BCL2L11-09       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2R9CA99_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2J8JCT2_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5NU92_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5HZI7_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5X2I7_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
F7HHA9_BCL2L11-04       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6E226_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5Z8B6_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I3M6I1_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6KJP8_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2K6QIL2_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2I2YQ13_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
O43521_BCL2L11-18       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I3HW02_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2R9CA99_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2J8JCT2_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5CAB2_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5CAB2_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
F6XMC1_BCL2L11-03       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6TRZ5_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6TRZ5_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6QIL2_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2K6QIL2_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2K5NU92_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5HZI7_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5X2I7_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6E226_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6E226_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K5Z8B6_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I3M6I1_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2K6KJP8_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2K6KJP8_BCL2L11      APTSLQTEPQGNPEDNHGG-------------------------------
A0A2I2YQ13_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
O43521_BCL2L11-03       APTSLQTEPQGNPEGNHGG-------------------------------
A0A2I3HW02_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2R9CA99_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
A0A2J8JCT2_BCL2L11      APTSLQTEPQGNPEGNHGG-------------------------------
F1SU81_BCL2L11-02       APTSLQTERQGNPEG-----------------------------------
A0A337SW42_BCL2L11      APTSLQTEQQGNPEG-----------------------------------
Q2YDF0_BCL2L11-02       APTSLQTERQGNPEG-----------------------------------
W5PY58_BCL2L11-01       APTSLQTERQGNPEG-----------------------------------
G1SSY0_BCL2L11-01       APTSLQSEPQGNP-------------------------------------
H0XW23_BCL2L11-01       APTSLHTEPQGNPEGNPEV-------------------------------
A0A337SW42_BCL2L11      APTSLQTEQQGNPEG-----------------------------------
G1LDR8_BCL2L11-01       APTSLQTEQQGNPEG-----------------------------------
J9NWV6_BCL2L11-01       APTSLQTEQQGNPEG-----------------------------------
F1SU81_BCL2L11-01       APTSLQTERQGNPEG-----------------------------------
O43521_BCL2L11-11       APTSLQTEPQ----------------------------------------
F7HHA9_BCL2L11-08       APTSLQTEPQ----------------------------------------
O54918_BCL2L11-08       APTSLQTEPQ----------------------------------------
O54918_BCL2L11-06       APTSLQTEPQ----------------------------------------
O54918_BCL2L11-03       APTSLQTEPQ----------------------------------------
O43521_BCL2L11-07       APTSLQTEPQ----------------------------------------
O43521_BCL2L11-19       APTSLQTEPQ----------------------------------------
A0A2I3HW02_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K6TRZ5_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5HZI7_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5NU92_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5Z8B6_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2I2YQ13_BCL2L11      APTSLQTEPQ----------------------------------------
O43521_BCL2L11-23       APTSLQTEPQ----------------------------------------
A0A2R9CA99_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2J8JCT2_BCL2L11      APTSLQTEPQ----------------------------------------
F7HHA9_BCL2L11-07       APTSLQTEPQ----------------------------------------
A0A2K5CAB2_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5X2I7_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2I3M6I1_BCL2L11      APTSLQTEPQ----------------------------------------
C1KGB8_BCL2L11-01       APTSLQTERQ----------------------------------------
A0A2K6GE31_BCL2L11      APTSLQTEPQ----------------------------------------
A0A337SW42_BCL2L11      APTSLQTEQQ----------------------------------------
O43521_BCL2L11-10       APTSLQTEPQ----------------------------------------
O43521_BCL2L11-20       APTSLQTEPQ----------------------------------------
A0A2I2YQ13_BCL2L11      APTSLQTEPQ----------------------------------------
O43521_BCL2L11-17       APTSLQTEPQ----------------------------------------
O43521_BCL2L11-13       APTSLQTEPQ----------------------------------------
A0A2I3HW02_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2R9CA99_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2J8JCT2_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5NU92_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5X2I7_BCL2L11      APTSLQTEPQ----------------------------------------
F7HHA9_BCL2L11-05       APTSLQTEPQ----------------------------------------
A0A2K5Z8B6_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5HZI7_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K6KJP8_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K6QIL2_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5CAB2_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5Z8B6_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K6KJP8_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K6QIL2_BCL2L11      APTSLQTEPQ----------------------------------------
F6XMC1_BCL2L11-09       APTSLQTEPQ----------------------------------------
A0A2K6TRZ5_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5HZI7_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2R9CA99_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2J8JCT2_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5NU92_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5X2I7_BCL2L11      APTSLQTEPQ----------------------------------------
F7HHA9_BCL2L11-09       APTSLQTEPQ----------------------------------------
A0A2K6E226_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2I3M6I1_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2I2YQ13_BCL2L11      APTSLQTEPQ----------------------------------------
O43521_BCL2L11-06       APTSLQTEPQ----------------------------------------
O43521_BCL2L11-15       APTSLQTEPQ----------------------------------------
A0A2I3HW02_BCL2L11      APTSLQTEPQ----------------------------------------
F1SU81_BCL2L11-03       APTSLQTERQ----------------------------------------
A0A0D9RWE0_BCL2L11      APTSLQTEPQ----------------------------------------
O43521_BCL2L11-05       APTSLQTEPQ----------------------------------------
O43521_BCL2L11-25       APTSLQTEPQ----------------------------------------
O54918_BCL2L11-05       APTSLQTEPQ----------------------------------------
O88498_BCL2L11-02       APTSLQTESQ----------------------------------------
A0A2K6GE31_BCL2L11      APTSLQTEPQ----------------------------------------
A0A286XJN2_BCL2L11      APTSLQTEPQ----------------------------------------
A0A337SW42_BCL2L11      APTSLQTEQQ----------------------------------------
A0A2K5CAB2_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K6TRZ5_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K6QIL2_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5NU92_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5HZI7_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5X2I7_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K6E226_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K5Z8B6_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2I3M6I1_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2I3M6I1_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2K6KJP8_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2I2YQ13_BCL2L11      APTSLQTEPQ----------------------------------------
O43521_BCL2L11-02       APTSLQTEPQ----------------------------------------
A0A2R9CA99_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2J8JCT2_BCL2L11      APTSLQTEPQ----------------------------------------
H2P5E2_BCL2L11-01       APTSLQTEPQ----------------------------------------
Q2YDF0_BCL2L11-01       APTSLQTERQ----------------------------------------
Q2YDF0_BCL2L11-03       APTSLQTERQ----------------------------------------
A0A287DFJ0_BCL2L11      APTSLQTEPQ----------------------------------------
A0A3B4B6Y3_BMF-01       ------MEDEEDDVFEPDL-------------------------------
A0A3B1JLM2_BAD-01       FTMEKTPPHSKEDDISPID-------------------------------
A0A3B4UNJ0_BMF-01       KYEDRATPIAAGQALTAVT-------------------------------
Q0GKC7_BMF-01           K----QTELAGRPAGSRNG-------------------------------
W5N4P7_BMF-01           KYEDKGTQTPSPALVHGDN-------------------------------
A0A3B3RH63_BMF-01       KCENRGTQTPGPALVQGLN-------------------------------
W5UAU7_BMF-01           KQEDHSTQTPGSPAVRLNG-------------------------------
A0A3B1K1X5_BMF-01       KQEERGTQTPGRPPARTNG-------------------------------
A0A3B4CNJ8_BMF-01       KQEERGTQTPGRPPARPNG-------------------------------
A0A2U9CJH3_BMF-01       KCEDRGTQTPGPALALNNG-------------------------------
A0A3B5KWG6_BMF-01       KCEDRGTQTPGPTLAPHSG-------------------------------
A0A3B3CGR9_BMF-01       KCEDRGTQTPGPALVPNNG-------------------------------
A0A3B3I0V9_BMF-04       KCEDRGTQTPGPALVPNNG-------------------------------
A0A3B3I0V9_BMF-01       KCEDRGTQTPGPALVPNNG-------------------------------
A0A3B3I0V9_BMF-02       KCEDRGTQTPGPALVPNNG-------------------------------
A0A3B3I0V9_BMF-03       KCEDRGTQTPGPALVPNNG-------------------------------
A0A3B4U5H8_BMF-01       KCEDRGTQTPGPALALNNG-------------------------------
A0A3B4WM88_BMF-01       KCEDRGTQTPGPALALNNG-------------------------------
I3K2D6_BMF-01           KCEHRGTQTPGPALVPNNG-------------------------------
A0A3B4ETH0_BMF-01       KCEHRGTQTPGPALVPNNG-------------------------------
A0A3B5B8F6_BMF-01       KCEDRGTQTPGPALQPNNG-------------------------------
A0A096LRV0_BMF-01       KCEDRGTQTPGPGQALHNG-------------------------------
A0A3B3WU80_BMF-01       KCEDRGTQTPGPGQALHNG-------------------------------
A0A3B5QK08_BMF-02       KCEDRGTQTPGPGQALHNG-------------------------------
A0A3B5QK08_BMF-01       KCEDRGTQTPGPGQALHNG-------------------------------
F6RS78_BIK-01           SRDLFLDAFLHERSPEALE-------------------------------
A0A2K5JY52_PMAIP1-      GKKARKNAQPSPARAQ-AG-------------------------------
A0A096MPU8_PMAIP1-      GKKARKNAQPSPTRAQ-AG-------------------------------
A0A2K5ZWH1_PMAIP1-      GKKARKNAQPSPTRAQ-AG-------------------------------
A0A2K5VPX2_PMAIP1-      GKKARKNAQPSPTRAQ-AG-------------------------------
A0A2K6BV75_PMAIP1-      GKKARKNAQPSPTRAQ-AG-------------------------------
A0A2K6KJF2_PMAIP1-      GKKARKNAQPSPARAQ-AG-------------------------------
A0A2K6NC45_PMAIP1-      GKKARKNAQPSPARAQ-AG-------------------------------
Q13794_PMAIP1-02        GKKARKNAQPSPARAP-AG-------------------------------
A0A2R9AKC9_PMAIP1-      GKKARKNAQPSPARAP-AG-------------------------------
A0A1D5QGJ8_PMAIP1-      GKKARKNAQPSPTRAQAAG-------------------------------
A0A2I2YVQ5_PMAIP1-      GKKARKNAQPSPARAP----------------------------------
A0A2I3SX38_PMAIP1-      GKKARKNAQPSPARAP----------------------------------
C1C3S9_BAD-01           MGDSPHKSMFSIEEFPPTE-------------------------------
A0A3B4CPH6_BAD-01       VPERFRESRQRNHSMNEDA-------------------------------
F6Z067_BAD-01           AVFKLEEFDNEEQGLPLPF-------------------------------
M3XHJ5_BCL2L11-01       --MPTEESLQFDKDQGTSD-------------------------------
W5QCU2_BIK-01           SRNLFLYTFLQNHGPGFLD-------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           ARDV-IKTVPHDQVPQPPV-------------------------------
O70337_BIK-01           ARDV-IKTVPHDQVPQPPV-------------------------------
Q925D2_BIK-01           ARDI-IKTLLHDQVPQPAV-------------------------------
G1TZR9_BIK-01           SRDLFQEALLDEQVPEPLL-------------------------------
H0W025_BIK-01           ARDPLMETPLFEPPPGPLL-------------------------------
A0A2K5CLG5_BIK-01       SSDILMETLLCEQFVHPLT-------------------------------
F7FUT7_BIK-01           SSDIFMETLLCEQFVDPLT-------------------------------
A0A2K6TBD7_BIK-01       SSDILMETLLCEQFVDPLT-------------------------------
H2P4N6_BIK-01           SRDILMETLLYEQLLEPPT-------------------------------
G1S1X2_BIK-01           SRDILMESLLYEQLLEPPT-------------------------------
G3QCT2_BIK-01           SRDILMETLLYEQLLEPPT-------------------------------
A0A2R8ZXD2_BIK-01       SRDILMETLLYEQLLEPPT-------------------------------
H2QLU7_BIK-01           SRDILMETLLYEQLLEPPT-------------------------------
Q13323_BIK-01           SRDILMETLLYEQLLEPPT-------------------------------
A0A2K6MCW0_BIK-01       SRDILMETLLYEQLLEPLT-------------------------------
A0A2K6QK74_BIK-01       SRDILMETLLYEQLLEPLT-------------------------------
A0A0D9QZY8_BIK-01       SRHILMESLLYEQLLEPLT-------------------------------
A0A2K5VW94_BIK-01       SRDTLMETLLYEQLLEPLT-------------------------------
A0A2K6DBJ4_BIK-01       SRDTLMETLLYEQLLEPLT-------------------------------
A0A2K5J4Q7_BIK-01       SRDILMETLLYEQLLEPLT-------------------------------
A0A096NKG5_BIK-01       SRDILMETLLYEQLLEPLT-------------------------------
A0A2K5LDM6_BIK-01       SRDTWMETLLYEQLLEPLT-------------------------------
A0A2K5XSA1_BIK-01       SRDTLMETLLYEQLLEPLT-------------------------------
F1PUF4_BIK-01           SRNLFLSTFLQEH--GPEV-------------------------------
H0XAE7_BIK-01           SMDHFMETFPFEQLLEPLT-------------------------------
A0A2K6FM79_BIK-01       STDLLMETFPFEHLLDPLI-------------------------------
F6RS78_BIK-02           NSGPLVSEPRSSSSYSVPKAVWSSVGEEMSQV------------------
A0A3B1JXK6_BCL2L11      RATRPPFLKEQGERGQSGG-------------------------------
A0A3B4BVX1_BCL2L11      RAGRPAFLKEQGESGQSSG-------------------------------
F6TGJ4_BMF-01           DDDV--FYPD--EFGYPDQ-------------------------------
G1PAU1_BMF-01           EDDV--FQPED-ELGTQPG-------------------------------
A2AV74_BMF-02           EDDV--FQSEDGEPGTQPG-------------------------------
A0A286XXB0_BMF-03       EDDV--FQPEDGEPGTQPG-------------------------------
I3MDS9_BMF-02           EDDV--FQPEDGEPGTQPG-------------------------------
A0A287AIU8_BMF-05       EDDV--FQPEEGEPGTQPR-------------------------------
A0A287AIU8_BMF-01       EDDV--FQPEEGEPGTQPR-------------------------------
A0A287AIU8_BMF-04       EDDV--FQPEEGEPGTQPR-------------------------------
A0A287AIU8_BMF-03       EDDV--FQPEEGEPGTQPR-------------------------------
A0A287AIU8_BMF-02       EDDV--FQPEEGEPGTQPR-------------------------------
W5UEE7_BCL2L11-01       DGPA--FLKEHGGRGESAS-------------------------------
H9GL49_BMF-01           EDDV--FHAEDCGLASQPS-------------------------------
K7FRX2_BMF-01           DDDV--FHSDDFGLTGQPG-------------------------------
A9XRG9_BMF-02           DDDV--FHSDDFGLAGQPG-------------------------------
A9XRG9_BMF-01           DDDV--FHSDDFGLAGQPG-------------------------------
U3JS06_BMF-01           DDDV--FHSDDFGLAGQPG-------------------------------
H0ZMX5_BMF-01           DDDV--FHSDDFGLAGQPG-------------------------------
A9XRG9_BMF-03           DDDV--FHSDDFGLAGQPG-------------------------------
A9XRG9_BMF-04           DDDV--FHSDDFGLAGQPG-------------------------------
G1NHG8_BMF-01           DDDV--FHSDDFGLAGQPG-------------------------------
A0A3B4V919_BCL2L11      TKPVRWLDRSNGKRGERRG-------------------------------
A0A3B4XZH1_BCL2L11      TKPVRWLDRSNGKRGERRG-------------------------------
A0A337SQV0_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5KGR6_BMF-01       EDDV--FQPEDGEPGAQPG-------------------------------
A0A2K6FFR1_BMF-02       EDDV--FQPEDGESGTQPG-------------------------------
M3WRS0_BMF-02           EDDV--FQPEDVEPGTQPG-------------------------------
A0A2K5E1W9_BMF-02       EDDV--FQSEDGEPGTQPG-------------------------------
F7HPK0_BMF-02           EDDV--FQPEDGEPGTQPG-------------------------------
A0A2K6TW86_BMF-03       EDDV--FQPEDGEPGTQPG-------------------------------
A0A2K6RAW8_BMF-02       EDDV--FQPEDGEPGAQPG-------------------------------
G3QIN5_BMF-02           EDDV--FQPEDGEPVTQPG-------------------------------
Q96LC9_BMF-07           EDDV--FQPEDGEPVTQPG-------------------------------
Q96LC9_BMF-05           EDDV--FQPEDGEPVTQPG-------------------------------
A0A2R9BS98_BMF-02       EDDV--FQPEDGEPVTQPG-------------------------------
A0A2J8QDD5_BMF-01       EDDV--FQPEDGEPVTQPG-------------------------------
A0A2K5MJY6_BMF-01       EDDV--FQPEDGEPGAQPG-------------------------------
G7PAW6_BMF-01           EDDV--FQPEDGEPGSQPG-------------------------------
A0A2K6B5G4_BMF-03       EDDV--FQPEDGEPGAQPG-------------------------------
A0A2K5Z4C3_BMF-02       EDDV--FQPEDGEPGAQPG-------------------------------
A0A096NTE9_BMF-03       EDDV--FQPEDGEPGAQPG-------------------------------
A0A2I3HD83_BMF-01       EDDV--FQPEDGEPGTQPG-------------------------------
A2AV74_BMF-01           EDDV--FQSEDGEPGTQPG-------------------------------
Q8K589_BMF-01           EDDV--FQPEDGEPGTQPG-------------------------------
I3MDS9_BMF-01           EDDV--FQPEDGEPGTQPG-------------------------------
G3T7Z4_BMF-01           EDDV--FQPEEGEPGTQPG-------------------------------
F6X3N6_BMF-01           EDDV--FHPEDSEPGAQPG-------------------------------
G3WDQ2_BMF-01           EDDV--FHPEDSEPGAQPG-------------------------------
Q96LC9_BMF-06           EDDV--FQPEDGEPVTQPG-------------------------------
F6TJI0_BMF-02           EDDV--FQPEDGEPGTQPR-------------------------------
F6TJI0_BMF-01           EDDV--FQPEDGEPGTQPR-------------------------------
A0A286XXB0_BMF-02       EDDV--FQPEDGEPGTQPG-------------------------------
J9PB65_BMF-01           EDDV--FQPEDGEPGTQPG-------------------------------
A0A286XXB0_BMF-01       EDDV--FQPEDGEPGTQPG-------------------------------
G1SR62_BMF-01           EDDV--FQPEDGEPGTQPQ-------------------------------
Q05KI3_BMF-02           EDDV--FQPEDGEPGTQPR-------------------------------
Q05KI3_BMF-01           EDDV--FQPEDGEPGTQPR-------------------------------
W5QFV1_BMF-01           EDDV--FQPEDGEPGAQPR-------------------------------
M3WRS0_BMF-01           EDDV--FQPEDVEPGTQPG-------------------------------
M3YAD5_BMF-01           EDDV--FQPEDGEPGTQPG-------------------------------
A0A2U4BC98_BMF-01       EDDV--FQPEDGEPGTQPG-------------------------------
A0A2K6FFR1_BMF-01       EDDV--FQPEDGESGTQPG-------------------------------
H0WYH6_BMF-01           EDDV--FQPEDGELGT--G-------------------------------
A0A096NTE9_BMF-01       EDDV--FQPEDGEPGAQPG-------------------------------
A0A2K6L933_BMF-02       EDDV--FQPEDGEPGAQPG-------------------------------
A0A096NTE9_BMF-02       EDDV--FQPEDGEPGAQPG-------------------------------
A0A2K5MJY6_BMF-02       EDDV--FQPEDGEPGAQPG-------------------------------
A0A2K5KGR6_BMF-02       EDDV--FQPEDGEPGAQPG-------------------------------
G7PAW6_BMF-02           EDDV--FQPEDGEPGSQPG-------------------------------
F7CM09_BMF-02           EDDV--FQPEDGEPGAQPG-------------------------------
A0A2K6B5G4_BMF-04       EDDV--FQPEDGEPGAQPG-------------------------------
A0A2K6B5G4_BMF-02       EDDV--FQPEDGEPGAQPG-------------------------------
A0A2K6B5G4_BMF-01       EDDV--FQPEDGEPGAQPG-------------------------------
A0A2K5Z4C3_BMF-01       EDDV--FQPEDGEPGAQPG-------------------------------
A0A2K6L933_BMF-01       EDDV--FQPEDGEPGAQPG-------------------------------
A0A2K6L933_BMF-03       EDDV--FQPEDGEPGAQPG-------------------------------
A0A2K6RAW8_BMF-01       EDDV--FQPEDGEPGAQPG-------------------------------
A0A0D9R4R5_BMF-01       EDDV--FQPEDGEPGAQPG-------------------------------
F7HPK0_BMF-01           EDDV--FQPEDGEPGTQPG-------------------------------
A0A2K5E1W9_BMF-01       EDDV--FQSEDGEPGTQPG-------------------------------
A0A2K6TW86_BMF-02       EDDV--FQPEDGEPGTQPG-------------------------------
A0A2K6TW86_BMF-01       EDDV--FQPEDGEPGTQPG-------------------------------
G3QIN5_BMF-01           EDDV--FQPEDGEPVTQPG-------------------------------
Q96LC9_BMF-02           EDDV--FQPEDGEPVTQPG-------------------------------
Q96LC9_BMF-01           EDDV--FQPEDGEPVTQPG-------------------------------
Q96LC9_BMF-04           EDDV--FQPEDGEPVTQPG-------------------------------
Q96LC9_BMF-03           EDDV--FQPEDGEPVTQPG-------------------------------
A0A2R9BS98_BMF-01       EDDV--FQPEDGEPVTQPG-------------------------------
A0A2J8QDD5_BMF-02       EDDV--FQPEDGEPVTQPG-------------------------------
A0A2J8T301_BMF-01       EDDV--FQPEDGEPGTQSG-------------------------------
A0A3B3VNE0_BCL2L11      TE----VTPAEGTGGDPAS-------------------------------
A0A3B3YII5_BCL2L11      TE----VTPAEGTGGDPAS-------------------------------
A0A3B3YII5_BCL2L11      TE----VTPAEGTGGDPAS-------------------------------
A0A3B5M375_BCL2L11      TE----VTPAEGTGGDPAS-------------------------------
A0A3B5QAM1_BCL2L11      TE----VTPAEGTGGDPAS-------------------------------
A0A3B5QAM1_BCL2L11      TE----VTPAEGTGGDPAS-------------------------------
E7FBJ6_BAD-01           LDEK--ERSHLKGT------------------------------------
B5XEF1_BAD-01           RNSE--FQLHVSTT------------------------------------
Q9GL49_PMAIP1-01        VRSQ--PRAHQGLTSGRCG-------------------------------
A0A3B4BVX1_BCL2L11      SGQS--SGAASSRAAEQCE-------------------------------
A0A3B4BVX1_BCL2L11      SGQS--SGAASSRAAEQCE-------------------------------
I3K7B6_BAD-01           GEEE---NQQPAGQDQE---------------------------------
A0A3B4GXJ6_BAD-01       GEGE---NQQSAGQAQE---------------------------------
B5X1T1_BAD-01           DES----DHSGTTHYPE---------------------------------
H3ANP3_BAD-03           RTGP--LPLQSGGGRGEGS-------------------------------
H3ANP3_BAD-01           RTGP--LPLQSGGGRGEGS-------------------------------
H3ANP3_BAD-02           RTGP--LPLQSGGGRGEGS-------------------------------
H3ANP3_BAD-04           RTGP--LPLQSGGGRGEGS-------------------------------
H3D8J8_BAD-01           EEGE--RGSFSTSGRIRVN-------------------------------
A0A3B5L9R9_BAD-01       EE----------RGDLQLM-------------------------------
A0A3B1IH05_BAD-01       GDS----DQPEVSKTAE---------------------------------
Q4V925_BAD-02           EDSS--LDKHKSGSAQK---------------------------------
Q4V925_BAD-03           EDSS--LDKHKSGSAQK---------------------------------
A7MCM4_BAD-01           EASS--LDKHKSGSAQK---------------------------------
Q4V925_BAD-04           EDSS--LDKHKSGSAQK---------------------------------
Q4V925_BAD-01           EDSS--LDKHKSGSAQK---------------------------------
A0A3B3BQF7_BAD-01       EGG----RLDLAASGGEGG-------------------------------
A0A2U9BAC9_BAD-01       EEG----EVSQPWTGPG---------------------------------
A0A3B4VFC5_BAD-01       DEG----EMSQSLTGQE---------------------------------
A0A3B4W9T1_BAD-01       DEG----EMSQSLTGQE---------------------------------
A0A3B3QX41_BAD-01       -------DTPDVTANSQ---------------------------------
A0A1W4YVX7_BAD-01       -------ETADSEAVSQ---------------------------------
A0A1W4YVX7_BAD-02       -------ETADSEAVSQ---------------------------------
A0A3B5K831_BAD-01       DEG----ERNSSLSEQE---------------------------------
A0A087X8P8_BAD-01       EER----GNLQLMQVKE---------------------------------
A0A3B3UA11_BAD-01       EER----GNLQLMQVKE---------------------------------
A0A3B3YFR1_BAD-01       EER----GNLQLMQVKE---------------------------------
A0A3B5Q2N7_BAD-01       EER----GDLQLMQEKE---------------------------------
A0A3B3HDU2_BAD-01       EGGK--LDLGAAAGGEG---------------------------------
G3Q8B3_BAD-01           EER----EDGQLSSGQE---------------------------------
A0A3B5BAL2_BAD-01       EEG----ENNHPPAEQP---------------------------------
A0A2D0SYM2_BAD-01       MDETPQSVRGDAGPVDDKESRWSETVE-----------------------
A0A3B4DUY7_BAD-01       MEKHSED--GISTMDDQDESNWSETVK-----------------------
A0A2I3HWI8_BBC3-03      MKFGMGSARACPCQVPRASSVTWVPCQI----------------------
A0A2K6FQZ3_BBC3-04      MKFGAGSARACPCQVPGTSFSWWVLGHI----------------------
Q9BXH1_BBC3-05          MKFGMGSAQACPCQVPRAASTTWVPCQI----------------------
A0A2R9BZA9_BBC3-01      MKFGMGSAQACPCQVPRAASVTWVPCQI----------------------
A0A2I3RGH5_BBC3-03      MKFGMGSAQACPCQVPRAASATWVPCQI----------------------
A0A2K5P2T8_BBC3-03      IKFGVGSARACPCQVPRAASATWVLCQI----------------------
A0A2K5V8J3_BBC3-03      IKFGVGSARACPCQVPRASSATWVPCQI----------------------
F7FFP6_BBC3-03          IKFGVGSARACPCQVPRASSATWVPCQI----------------------
A0A2K6ASP2_BBC3-03      IKFGVGSARACPCQVPRASSATWVPCQI----------------------
A0A2I3N2Z9_BBC3-03      IKFGVGSARACPCQVPRASSATWVPCQI----------------------
A0A2K6QZU4_BBC3-04      IKFGVGSARACPCQVPRASSATWVPCQI----------------------
A0A2R8MW85_BBC3-03      MKCGVGSAWACPCQVPRASSSVWVPCQM----------------------
A0A2K6STD6_BBC3-02      MKCGMGSAWACPCQVPRASSLTWVPCQM----------------------
G3T2N1_BBC3-01          CEPGLPRV-AGPRLLPGPRTQLFPSPSPVWVSDLSGLQLERGGAEWEDRA
M3Y0R3_BBC3-01          WESDCSPRVAAHGLFRAGAAAVSQPPPPPVWVSLTSQRTIVGGSVGRARG
Q99ML1_BBC3-02          CEPGLPAAPAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGHRSRPRG
Q80ZG6_BBC3-01          CEPGLPAAPAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGHRSRPRG
H0XQ00_BBC3-01          CEPGLPAAPAAPALLP--AAYLCAPTAPPAVTATLGGPRWPGGPRSRPRG
J9NTK9_BBC3-01          CEPGLPAAPAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGPRSRPRG
A0A337SQV0_BBC3-02      CEPGLPAAPAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGPRSRPRG
F1RM01_BBC3-01          CEPGLPAAPAAPTLLP--AAYLCAPTAPPAVTAALGGPRWPGGPRSRPRG
A0A2K6FQZ3_BBC3-01      CEPGLPAAPAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGPRSRPRG
Q9BXH1_BBC3-06          CEPGLAAAPAAPTLLP--AAYLCAPTAPPAVTAALGGSRWPGGPRSRPRG
A0A2I3RIG5_BBC3-02      CEPGLAAAPAAPTLLP--AAYLCAPTAPPAVTAALGGPRWPGGPRSRPRG
H2NZD3_BBC3-01          CEPGLAAAPAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGPRSRPRG
A0A2K6QZU4_BBC3-01      CEPGLAATPAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGPRSRPRG
A0A0D9S2H2_BBC3-01      CEPGLAAAPAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGPRSRPRG
B4DQK3_BBC3-01          CEPGLAAAPAAPTLLP--AAYLCAPTAPPAVTAALGGSRWPGGPRSRPRG
G1SS60_BAD-01           --------------------------------------------------
K7E5Y2_BBC3-02          CEAGLNPSGDSMCPAPGPALAPSSLLPLAYFCTRQ---------------
A0A337SAW2_BAD-01       TDRGLGPSPTGDRP-RGPG--------------KH---------------
A0A2I3TBK7_BAD-01       AERGLGPSPAGDGP-SGSG--------------KH---------------
A0A2R8Z697_BAD-02       AERGLGPSPAGDGP-SGSS--------------KH---------------
A0A2I2Z8C7_BAD-03       AERGLGPSPAGDGP-SGSG--------------KH---------------
Q92934_BAD-03           AERGLGPSPAGDGP-SGSG--------------KH---------------
A0A2K5M0C1_BAD-02       AERGLGPSLAGDRP-SDCG--------------KH---------------
A0A2K5XJR2_BAD-02       AERGLGPSLAGDRP-SDCG--------------KH---------------
A0A2I3MCN5_BAD-03       AERGLGPSPAGDKP-SDSG--------------KH---------------
A0A2K5VCD8_BAD-02       AERGLGPSPAGDRP-SDSG--------------KH---------------
F7GVS7_BAD-02           AERGLGPSPAGDRP-SDSG--------------KH---------------
A0A2K6E7J3_BAD-02       AERGLGPSPAGDRP-SDSG--------------KH---------------
A0A2K5E6K7_BAD-02       AERGLSPSTAGDRP-PGSG--------------KH---------------
A0A2K6TG62_BAD-02       AERGLSPSTAGDSP-PGSG--------------KH---------------
A0A2K5E6K7_BAD-03       AERGLSPSTAGDRP-PGSG--------------KH---------------
A0A2K5HKW9_BAD-02       AERGLGPSPAGDRP-SDSG--------------KH---------------
A0A2K6N1A1_BAD-02       AERGLGPSPAGDRP-SDSG--------------KH---------------
A0A2K6PUM5_BAD-02       AERGLGPSPAGDRP-SDSG--------------KH---------------
A0A2K5M0C1_BAD-03       AERGLGPSLAGDRP-SDCG--------------KH---------------
A0A2K5VCD8_BAD-03       AERGLGPSPAGDRP-SDSG--------------KH---------------
F7GVS7_BAD-03           AERGLGPSPAGDRP-SDSG--------------KH---------------
A0A2K5XJR2_BAD-03       AERGLGPSLAGDRP-SDCG--------------KH---------------
A0A2I3MCN5_BAD-02       AERGLGPSPAGDKP-SDSG--------------KH---------------
A0A2K6E7J3_BAD-03       AERGLGPSPAGDRP-SDSG--------------KH---------------
A0A2I2Z8C7_BAD-04       AERGLGPSPAGDGP-SGSG--------------KH---------------
Q92934_BAD-04           AERGLGPSPAGDGP-SGSG--------------KH---------------
A0A2I3TBK7_BAD-03       AERGLGPSPAGDGP-SGSG--------------KH---------------
A0A2R8Z697_BAD-03       AERGLGPSPAGDGP-SGSS--------------KH---------------
F6SJL0_BAD-02           AERGLSPSTAGDRP-PGSG--------------KH---------------
A0A2K6TG62_BAD-03       AERGLSPSTAGDSP-PGSG--------------KH---------------
G1P8C5_BAD-01           ADRGLGPCPTGDQP-PGLN--------------KH---------------
W5P8G9_BAD-01           ADRGLGPSPTGDRP-PGLS--------------KH---------------
G3VRY4_BAD-02           ASTAPSLAPLRPGPRAAPG--------------AH---------------
G3VRY4_BAD-01           ASTAPSLAPLRPGPRAAPG--------------AH---------------
I3MBM5_BAD-02           AEGGLGPSPAGDRP-G----------------------------------
I3MBM5_BAD-01           AEGGLGPSPAGDRP-G----------------------------------
Q61337_BAD-03           TDRGLGPSLTEDQP-G----------------------------------
Q61337_BAD-01           TDRGLGPSLTEDQP-G----------------------------------
Q61337_BAD-02           TDRGLGPSLTEDQP-G----------------------------------
G3TP47_BAD-01           ADRGLGPSPEGYWP-SGPS--------------DR---------------
F7DN67_BAD-01           ADRGLGPSPTGDWP-SDPV--------------RH---------------
G1MI17_BAD-01           ADRGLGPSPTGDQP-PGPG--------------KH---------------
A0A287AEF3_BAD-01       ADRGLGPSPTGTDP-------------------QP---------------
O35147_BAD-01           TDRGLGPSLTEDQP-G----------------------------------
M3YNE7_BAD-01           ADRGLGPSPTGDQP-PGLG--------------KH---------------
F1MUT9_BAD-01           ADRGLGPSPTGDRP-PGLS--------------KH---------------
Q3SYZ0_BAD-01           ADRGLGPSPTGDRP-PGLS--------------KH---------------
H0WVR2_BAD-01           SDRGLGPSPSGDQP-LGPG--------------KN---------------
H0V608_BAD-01           EERGLGPSPTGDEL-GSS--------------------------------
A0A2K5E6K7_BAD-01       AERGLSPSTAGDRP-PGSG--------------KH---------------
A0A2K6TG62_BAD-01       AERGLSPSTAGDSP-PGSG--------------KH---------------
A0A0D9R491_BAD-01       AERGLGPSPAGNRP-SDSG--------------KH---------------
A0A2K5M0C1_BAD-01       AERGLGPSLAGDRP-SDCG--------------KH---------------
A0A2K5VCD8_BAD-01       AERGLGPSPAGDRP-SDSG--------------KH---------------
F7GVS7_BAD-01           AERGLGPSPAGDRP-SDSG--------------KH---------------
A0A2K6E7J3_BAD-01       AERGLGPSPAGDRP-SDSG--------------KH---------------
A0A2K5XJR2_BAD-01       AERGLGPSLAGDRP-SDCG--------------KH---------------
A0A2I3MCN5_BAD-04       AERGLGPSPAGDKP-SDSG--------------KH---------------
A0A2K6N1A1_BAD-01       AERGLGPSPAGDRP-SDSG--------------KH---------------
A0A2K6PUM5_BAD-01       AERGLGPSPAGDRP-SDSG--------------KH---------------
A0A2K5HKW9_BAD-01       AERGLGPSPAGDRP-SDSG--------------KH---------------
B4DZQ9_BAD-01           AERGLGPSPAGDGP-SGSG--------------KH---------------
A0A2K6GWV0_BAD-01       AGRGLGPSPSGDRP-SGPG--------------KH---------------
F6SJL0_BAD-01           AERGLSPSTAGDRP-PGSG--------------KH---------------
A0A2I3MCN5_BAD-01       AERGLGPSPAGDKP-SDSG--------------KH---------------
A0A2I2Z8C7_BAD-02       AERGLGPSPAGDGP-SGSG--------------KH---------------
A0A2I2Z8C7_BAD-01       AERGLGPSPAGDGP-SGSG--------------KH---------------
Q92934_BAD-01           AERGLGPSPAGDGP-SGSG--------------KH---------------
Q92934_BAD-02           AERGLGPSPAGDGP-SGSG--------------KH---------------
A0A2I3TBK7_BAD-02       AERGLGPSPAGDGP-SGSG--------------KH---------------
A0A2R8Z697_BAD-01       AERGLGPSPAGDGP-SGSS--------------KH---------------
A0A2J8TYJ3_BAD-01       AERGLGPSPAGDRP-SGSS--------------KH---------------
F1PK10_BAD-01           ANRGLGPSPTGDRP-PSPG--------------KH---------------
Q45KI9_BAD-01           ANRGLGPSPTGDRP-PSPG--------------KH---------------
                                                                          

A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          RRVHAPGGLGVGLRSGECAPRLGVRVPCRERGPLSPRCCCRCECGAGLGK
A9XRH0_BMF-01           ----------------------------------LAGNAGY---RLHVPP
R4G9R5_BCL2L11-01       ----------------------------------RTGRRWC-----EAET
A3KND0_BMF-01           ----------------------------------QSQSYTCLLGRFHLFP
Q6P7C5_BAD-01           ----------------------------------PSEQEDA-------ST
A0A287AEF3_BAD-02       ----------------------------------QSEQEDS-------SP
I3LVX0_BIK-01           --------------------------------------------------
O61667_EGL1-01          ----------------------------------VFYNEKNMFYSSSQDF
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9JM54_PMAIP1-01        ----------------------------------AQLRKIGDKVYCTWSA
Q5U777_PMAIP1-01        ----------------------------------AQLRKIGDKVYCTWSA
F1SMU1_PMAIP1-01        ----CCFSSSLPLARFCPTAPRAACYLQSQGARVRGLSSRSFAAKFRLLF
Q9BXH1_BBC3-04          --------------------------------------------------
B2KKY9_BCL2L11-01       ----GGISMSNNQSRSPM---------------------NRTFSRSSSGY
B8JK68_BCL2L11-01       ----GGISMSNNQSRSPM---------------------NRTFSRSSSGY
A0A3B3QC78_BCL2L11      ---------------------------------------FSTLSASSSGY
A0A2K6KS56_BBC3-02      --------------------------------------------------
F7G1G0_HRK-01           ------------------------------------QRAAAAAQLTAARL
P62816_HRK-03           ------------------------------------LR-WAAAQVTALRL
P62817_HRK-01           ------------------------------------LR-WAAAQVTALRL
A0A287A5N9_HRK-01       ------------------------------------LR-SSAAQLTAARL
H2NIS8_HRK-01           ------------------------------------LR-SSAAQLTAARL
A0A2K5KZ69_HRK-01       ------------------------------------LR-SSAAQLTAARL
H2Q6Y8_HRK-01           ------------------------------------LR-SSAAQLTAARL
G3UH24_HRK-01           ------------------------------------LR-SSAAQLTAARL
A0A2K5BYA0_HRK-01       ------------------------------------LR-SSAAQLTAARL
U3E722_HRK-01           ------------------------------------LR-SSAAQLTAARL
A0A0D9SC73_HRK-01       ------------------------------------LR-SSAAQLTAARL
A0A337SQ56_HRK-01       ------------------------------------LR-SSAAQLTAARL
G3QTJ6_HRK-01           ------------------------------------LR-SSAAQLTAARL
O00198_HRK-01           ------------------------------------LR-SSAAQLTAARL
A0A1D5R1E4_HRK-01       ------------------------------------LR-SSAAQLTAARL
A0A2K6AYL7_HRK-01       ------------------------------------LR-SSAAQLTAARL
G1QHD8_HRK-01           ------------------------------------LR-SSAAQLTAARL
G1T7W1_HRK-01           ------------------------------------LR-SAAAQLTAARL
H0Y001_HRK-01           ------------------------------------LR-SSAAQLTAARL
A0A096N944_HRK-01       ------------------------------------LR-SSAAQLTAARL
A0A2K6GL98_HRK-01       ------------------------------------LR-SSAAQLTAARL
E2RLD4_HRK-01           ------------------------------------LR-SSAAQLTAARL
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
G3SU55_BCL2L11-01       ----EGDSCPQGSPQGPQAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
G3W979_BCL2L11-01       ----EGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFVRRSPLLPRSSSGY
Q4KMV9_BCL2L11-01       ----EGGSSSASTPWGPTISPYSPSSFVNRSPHCMLVRGSSLVSKTSSGY
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      ------------------------GPFATRSP------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       ----EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
F7CXT2_BCL2L11-01       ----EGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFLRRSPLLPRSSSGY
O54918_BCL2L11-01       ----EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
O88498_BCL2L11-01       ----EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
A0A337SW42_BCL2L11      ----EGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGY
A0A337SW42_BCL2L11      ----EGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGY
A0A2K5NU92_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5HZI7_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I2YQ13_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
O43521_BCL2L11-22       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
O43521_BCL2L11-08       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5X2I7_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
F7HHA9_BCL2L11-03       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6E226_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5Z8B6_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I3HW02_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2R9CA99_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2J8JCT2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I3M6I1_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6KJP8_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6QIL2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5CAB2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
F6XMC1_BCL2L11-06       ----EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K6TRZ5_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K5CAB2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K6TRZ5_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K5CAB2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
F6XMC1_BCL2L11-04       ----EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K6TRZ5_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K5NU92_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5HZI7_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I2YQ13_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
O43521_BCL2L11-24       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
O43521_BCL2L11-12       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5X2I7_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
F7HHA9_BCL2L11-06       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6E226_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5Z8B6_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I3HW02_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2R9CA99_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2J8JCT2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I3M6I1_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6KJP8_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6QIL2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5NU92_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I2YQ13_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
O43521_BCL2L11-21       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5X2I7_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
F7HHA9_BCL2L11-01       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6E226_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5Z8B6_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I3HW02_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2R9CA99_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2J8JCT2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I3M6I1_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6KJP8_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6QIL2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5HZI7_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6GE31_BCL2L11      ----EGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
A0A2K6GE31_BCL2L11      ----EGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
F6XMC1_BCL2L11-08       ----EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K6GE31_BCL2L11      ----EGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
A0A2K6GE31_BCL2L11      ----EGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
A0A287DFJ0_BCL2L11      ----EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
A0A286XJN2_BCL2L11      ----AGDRSPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
A0A286XJN2_BCL2L11      ----AGDRSPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
A0A2K5CAB2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
F6XMC1_BCL2L11-07       ----EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K6TRZ5_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
F6XMC1_BCL2L11-05       ----EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K6TRZ5_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K5CAB2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K5NU92_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5HZI7_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5X2I7_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
F7HHA9_BCL2L11-02       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6E226_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5Z8B6_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I3M6I1_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6KJP8_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6QIL2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I2YQ13_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
O43521_BCL2L11-16       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
O43521_BCL2L11-09       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2R9CA99_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2J8JCT2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5NU92_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5HZI7_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5X2I7_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
F7HHA9_BCL2L11-04       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6E226_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5Z8B6_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I3M6I1_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6KJP8_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6QIL2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I2YQ13_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
O43521_BCL2L11-18       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I3HW02_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2R9CA99_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2J8JCT2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5CAB2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K5CAB2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
F6XMC1_BCL2L11-03       ----EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K6TRZ5_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K6TRZ5_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGY
A0A2K6QIL2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6QIL2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5NU92_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5HZI7_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5X2I7_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6E226_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6E226_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K5Z8B6_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I3M6I1_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6KJP8_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2K6KJP8_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I2YQ13_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
O43521_BCL2L11-03       ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2I3HW02_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2R9CA99_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
A0A2J8JCT2_BCL2L11      ----EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGY
F1SU81_BCL2L11-02       ----EGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSSLLSRSSSGY
A0A337SW42_BCL2L11      ----EGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGY
Q2YDF0_BCL2L11-02       ----EGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
W5PY58_BCL2L11-01       ----EGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
G1SSY0_BCL2L11-01       ----EGDRCAHGSPQGPLAPSASPGPFATRSPLFIFVRRSSLLSRSSSGY
H0XW23_BCL2L11-01       ----EGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
A0A337SW42_BCL2L11      ----EGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGY
G1LDR8_BCL2L11-01       ----EGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
J9NWV6_BCL2L11-01       ----EGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
F1SU81_BCL2L11-01       ----EGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSSLLSRSSSGY
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-03       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A3B1JLM2_BAD-01       ----DHDESRWSEAVKSVDSP--------------QTDSGPSMYRDTSSD
A0A3B4UNJ0_BMF-01       ----AA--------------P-------------LILFVWWVPHWELSPS
Q0GKC7_BMF-01           ----ML-LCRHLQQ----------------------------HGHFLYGN
W5N4P7_BMF-01           ----ML-PCGVGAE----------------------------PRRLFYGN
A0A3B3RH63_BMF-01       ----ML-PCGVGQE----------------------------PRRLFYGS
W5UAU7_BMF-01           ----ML-PCGVAEE----------------------------PRRLFYGS
A0A3B1K1X5_BMF-01       ----ML-PCGISEE----------------------------PRRLFYGS
A0A3B4CNJ8_BMF-01       ----ML-PCGVSEE----------------------------PRRLFYGS
A0A2U9CJH3_BMF-01       ----ML-PCGVAEE----------------------------PRPLFYGN
A0A3B5KWG6_BMF-01       ----ML-PCGVAEE----------------------------PRLLFYGE
A0A3B3CGR9_BMF-01       ----ML-LCGLAEE----------------------------PRPLFYGN
A0A3B3I0V9_BMF-04       ----ML-LCGLAEE----------------------------PRPLFYGN
A0A3B3I0V9_BMF-01       ----ML-LCGLAEE----------------------------PRPLFYGN
A0A3B3I0V9_BMF-02       ----ML-LCGLAEE----------------------------PRPLFYGN
A0A3B3I0V9_BMF-03       ----ML-LCGLAEE----------------------------PRPLFYGN
A0A3B4U5H8_BMF-01       ----ML-PCGVAKE----------------------------PRPLFYGN
A0A3B4WM88_BMF-01       ----ML-PCGVAKE----------------------------PRPLFYGN
I3K2D6_BMF-01           ----ML-PCGVAEE----------------------------PRPLFYGN
A0A3B4ETH0_BMF-01       ----ML-PCGVAEE----------------------------PRPLFYGN
A0A3B5B8F6_BMF-01       ----ML-PCGVAEE----------------------------PRPLFYGN
A0A096LRV0_BMF-01       ----ML-PCGVAEE----------------------------PRRLFYGN
A0A3B3WU80_BMF-01       ----ML-PCGVAEE----------------------------PRRLFYGN
A0A3B5QK08_BMF-02       ----ML-PCGVVEE----------------------------PRRLFYGN
A0A3B5QK08_BMF-01       ----ML-PCGVVEE----------------------------PRRLFYGN
F6RS78_BIK-01           ----VPGMTELTESSPDSD-----------------------------NR
A0A2K5JY52_PMAIP1-      ----T-DPLGPAKT--QAGRG-------------RG------RGKKLL--
A0A096MPU8_PMAIP1-      ----QAGTAGTARD--QAGFG-------------IGMQLHFTRSKKLV--
A0A2K5ZWH1_PMAIP1-      ----QAGTAGTARD--QAGFG-------------IGMQLHFTRGKKLV--
A0A2K5VPX2_PMAIP1-      ----QAGTAGTARD--QAGFG-------------IGMQLHYTRGKKLV--
A0A2K6BV75_PMAIP1-      ----PAGTAGTARD--QAGFG-------------IGMQLHYTRGKKLV--
A0A2K6KJF2_PMAIP1-      ----PAGTAGTARD--QAGLG-------------IGMQLHFTRGKKLL--
A0A2K6NC45_PMAIP1-      ----PAGTAGTARD--QAGLG-------------IGMQLHFTRGKKLL--
Q13794_PMAIP1-02        ----PAGTAGTARD--QAGFA-------------IGMQLRFTRGKKLLSS
A0A2R9AKC9_PMAIP1-      ----P---AGTARD--QAGFG-------------IGMQLRFTRGKKLLSS
A0A1D5QGJ8_PMAIP1-      ----TAGTAGTARD--QAGFG-------------IGMQLHYTRGKKLVSS
A0A2I2YVQ5_PMAIP1-      -----AGPAGTARD--QAGFG-------------IEMQLRFTRGKKLLSS
A0A2I3SX38_PMAIP1-      -----AGPAGTARD--QAGFG-------------IGMQLRFTRGKKLLSS
C1C3S9_BAD-01           ----RGSAFSGTNPPGFGGDP-------------GHKS--SPNLRRIKGK
A0A3B4CPH6_BAD-01       ----LQESGAVRHGDGAADGD-------------SFRRRCRSAPPALWAA
F6Z067_BAD-01           ----VD------PPRGAGVRQ-------------PVAK--SSPSLRRYPG
M3XHJ5_BCL2L11-01       ----VISECGHLHPTQRPDQP-------------PFVK--QEGCYCIISP
W5QCU2_BIK-01           ----DQ-GSGLPGVTSILEFH-------------PISP--YS-----DSP
O70337_BIK-04           ----------------------------------------------MFTR
O70337_BIK-02           ----ASETPSMKE---------------------PVRD--VDLMECVEGR
O70337_BIK-01           ----ASETPSMKE---------------------PVRD--VDLMECVEGR
Q925D2_BIK-01           ----VSGAPSMKEPVGVEDVS-------------PVRD--LDFMRCLESR
G1TZR9_BIK-01           ----TAEVPGLTRPVEEGDLD---------------------LMECLEGS
H0W025_BIK-01           ----AEGALGVTQPLWAEDLS-------------PPGD--TNLMECVEGS
A0A2K5CLG5_BIK-01       ----ME-VVGGSDP--EEDLD-------------PVED----PLECMENS
F7FUT7_BIK-01           ----ME-VVGGSDP--EEDLD-------------PVED----PLECMENS
A0A2K6TBD7_BIK-01       ----ME-VVGGSDP--EEDPD-------------SVED----PLECMENS
H2P4N6_BIK-01           ----ME-VLGVTDS--EEDLD-------------PMED--FSPLECMEGS
G1S1X2_BIK-01           ----ME-VLGVTDP--EEDLD-------------PMED--FDPLQCMEGS
G3QCT2_BIK-01           ----ME-VLGVTDS--EEDLD-------------PMED--FDSLECMEGS
A0A2R8ZXD2_BIK-01       ----ME-VLGVTES--EEDLD-------------PMED--FDSLECMEGS
H2QLU7_BIK-01           ----ME-VLGVTDS--EEDLD-------------PMED--FDSLECMEGS
Q13323_BIK-01           ----ME-VLGMTDS--EEDLD-------------PMED--FDSLECMEGS
A0A2K6MCW0_BIK-01       ----ME-VLGVTDP--EEDLD-------------PMED--FDPLECMEDS
A0A2K6QK74_BIK-01       ----ME-VLGVTDP--EEDLD-------------PMED--FDPLECMEDS
A0A0D9QZY8_BIK-01       ----ME-VLGVTDP--EEDLD-------------PMED--FDPLECMEDS
A0A2K5VW94_BIK-01       ----ME-VLGVTDP--EEDLD-------------PMED--FNPLECMEDS
A0A2K6DBJ4_BIK-01       ----ME-VLGVTDP--EEDLD-------------PMED--FDPLECIEDS
A0A2K5J4Q7_BIK-01       ----ME-VLGVTDP--EEDLD-------------PMED--FDPLECMEDS
A0A096NKG5_BIK-01       ----ME-VLGVTDP--EEDLD-------------PMED--FDPLECMEDS
A0A2K5LDM6_BIK-01       ----ME-VLGVTDP--EEDLD-------------PMED--FDPLECMEDS
A0A2K5XSA1_BIK-01       ----ME-VLGVTDP--EEDLD-------------PMED--FDPLECMEDS
F1PUF4_BIK-01           ----LE-VPGMTDL--VEYYD-------------P------GPSPNSNNP
H0XAE7_BIK-01           ----ME-VLGMTE---------------------P------NPMECLEDS
A0A2K6FM79_BIK-01       ----LE-VLSIMDN--EE--N-------------P------DPSGCLEDS
F6RS78_BIK-02           ----GPVSRDLFLDAFLHERS----------------------PEALEVP
A0A3B1JXK6_BCL2L11      ----GGGTLSRAEQCEQPEPG--------------------DGDPVR-GP
A0A3B4BVX1_BCL2L11      ----AASSRA-AEQCEQPEPG--------------------EGDPVR-GG
F6TGJ4_BMF-01           ----TMTSSTVFNQSQSYTCL-------------LSRFHLFPLSHCC-GP
G1PAU1_BMF-01           ----SLPSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
A2AV74_BMF-02           ----GLLSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
A0A286XXB0_BMF-03       ----SLLSADLFAQSQ-LDCP-------------LGRLHLFPLTHCC-GP
I3MDS9_BMF-02           ----SLLSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
A0A287AIU8_BMF-05       ----R-VSADPFVQSQ-LDCP-------------LSRLQLFPLTHCC-GP
A0A287AIU8_BMF-01       ----R-VSADPFVQSQ-LDCP-------------LSRLQLFPLTHCC-GP
A0A287AIU8_BMF-04       ----R-VSADPFVQSQ-LDCP-------------LSRLQLFPLTHCC-GP
A0A287AIU8_BMF-03       ----R-VSADPFVQSQ-LDCP-------------LSRLQLFPLTHCC-GP
A0A287AIU8_BMF-02       ----R-VSADPFVQSQ-LDCP-------------LSRLQLFPLTHCC-GP
W5UEE7_BCL2L11-01       ----RAEPYESPQHRE-LEVIRGGIALPNSRVAYQSRSPVFRTLSRS-SS
H9GL49_BMF-01           ----EMTFPGIFTQSKSYNCL-------------LGRFQLFPLTHCC-GP
K7FRX2_BMF-01           ----EMTPTGIFTQNQSYSCL-------------LGRFQLFPLTHCC-GP
A9XRG9_BMF-02           ----EMTATGIFTQNQSYSCL-------------LGRFQLFPLTHCC-GP
A9XRG9_BMF-01           ----EMTATGIFTQNQSYSCL-------------LGRFQLFPLTHCC-GP
U3JS06_BMF-01           ----EMTATGFFTQNQSYSCL-------------LGRFQLFPLTHCC-GP
H0ZMX5_BMF-01           ----EMTATGFFTQNQSYSCL-------------LGRFQLFPLTHCC-GP
A9XRG9_BMF-03           ----EMTATGIFTQNQSYSCL-------------LGRFQLFPLTHCC-GP
A9XRG9_BMF-04           ----EMTATGIFTQNQSYSCL-------------LGRFQLFPLTHCC-GP
G1NHG8_BMF-01           ----EMTATGIFTQNQSYSCL-------------LGRFQLFPLTHCC-GP
A0A3B4V919_BCL2L11      ----STTRRCRWS------------------------------------P
A0A3B4XZH1_BCL2L11      ----STTRRCRWS------------------------------------P
A0A337SQV0_BBC3-01      ----VYLSAGAARACP-RQVP---------------GASFFPGC-----P
Q9BXH1_BBC3-03          ----MKFGMGSAQACP-CQVP-------------RAASTTWVPCQIC-GP
A0A2K5KGR6_BMF-01       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6FFR1_BMF-02       ----SVLSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
M3WRS0_BMF-02           ----SLLSANLFAQSQ-LDCP-------------LSHLQLFPLTHCC-GP
A0A2K5E1W9_BMF-02       ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
F7HPK0_BMF-02           ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6TW86_BMF-03       ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6RAW8_BMF-02       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
G3QIN5_BMF-02           ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
Q96LC9_BMF-07           ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
Q96LC9_BMF-05           ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2R9BS98_BMF-02       ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2J8QDD5_BMF-01       ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K5MJY6_BMF-01       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
G7PAW6_BMF-01           ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6B5G4_BMF-03       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K5Z4C3_BMF-02       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A096NTE9_BMF-03       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2I3HD83_BMF-01       ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A2AV74_BMF-01           ----GLLSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
Q8K589_BMF-01           ----SLLSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
I3MDS9_BMF-01           ----SLLSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
G3T7Z4_BMF-01           ----GLLSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
F6X3N6_BMF-01           ----GLTSAALFAQSQ-PDYM-------------LDGLQLFPLTHCC-GP
G3WDQ2_BMF-01           ----GLTSPALFAQSQ-PDYM-------------LDGLQLFPLTHCC-GP
Q96LC9_BMF-06           ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
F6TJI0_BMF-02           ----SLLSADLFAPSQ-LDCP-------------LSHLRLFPLTHCC-GP
F6TJI0_BMF-01           ----SLLSADLFAPSQ-LDCP-------------LSHLRLFPLTHCC-GP
A0A286XXB0_BMF-02       ----SLLSADLFAQSQ-LDCP-------------LGRLHLFPLTHCC-GP
J9PB65_BMF-01           ----SLLSADLFAQSQ-LDCP-------------LSRLHLFPLTHCC-GP
A0A286XXB0_BMF-01       ----SLLSADLFAQSQ-LDCP-------------LGRLHLFPLTHCC-GP
G1SR62_BMF-01           ----SLLSADPFAQSQ-LDCP-------------LGRLHLFPLTHCC-GP
Q05KI3_BMF-02           ----SLLSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
Q05KI3_BMF-01           ----SLLSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
W5QFV1_BMF-01           ----RLLSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
M3WRS0_BMF-01           ----SLLSANLFAQSQ-LDCP-------------LSHLQLFPLTHCC-GP
M3YAD5_BMF-01           ----SLLSADLFAQSQ-LDCP-------------LSRLHLFPLTHCC-GP
A0A2U4BC98_BMF-01       ----SLLSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6FFR1_BMF-01       ----SVLSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
H0WYH6_BMF-01           ----NVLSADLFAQSQ-LDCP-------------LSRLQLFPLTHCC-GP
A0A096NTE9_BMF-01       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6L933_BMF-02       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A096NTE9_BMF-02       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K5MJY6_BMF-02       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K5KGR6_BMF-02       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
G7PAW6_BMF-02           ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
F7CM09_BMF-02           ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6B5G4_BMF-04       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6B5G4_BMF-02       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6B5G4_BMF-01       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K5Z4C3_BMF-01       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6L933_BMF-01       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6L933_BMF-03       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6RAW8_BMF-01       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A0D9R4R5_BMF-01       ----SSLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
F7HPK0_BMF-01           ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K5E1W9_BMF-01       ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6TW86_BMF-02       ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2K6TW86_BMF-01       ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
G3QIN5_BMF-01           ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
Q96LC9_BMF-02           ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
Q96LC9_BMF-01           ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
Q96LC9_BMF-04           ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
Q96LC9_BMF-03           ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2R9BS98_BMF-01       ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2J8QDD5_BMF-02       ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A2J8T301_BMF-01       ----SLLSADLFAQSL-LDCP-------------LSRLQLFPLTHCC-GP
A0A3B3VNE0_BCL2L11      ----SARTPRSSKHTE-RSCA-------------PQTGASTAGGGGG-GG
A0A3B3YII5_BCL2L11      ----SARTPRSSKHTE-RSCA-------------PQAGASTAGGGGG-GG
A0A3B3YII5_BCL2L11      ----SARTPRSSKHTE-RSCA-------------PQAGASTAGGGGG-GG
A0A3B5M375_BCL2L11      ----SARTPRSSKHTE-RSRA-------------PQAGASTAGGGGG-GE
A0A3B5QAM1_BCL2L11      ----SARTPRSSKHTE-RSRA-------------PQAGASTAGGGGG-GE
A0A3B5QAM1_BCL2L11      ----SARTPRSSKHTE-RSRA-------------PQAGASTAGGGGG-GE
E7FBJ6_BAD-01           ------------IKNHGQHQD-------------RTSANISPQGRVR-LY
B5XEF1_BAD-01           ------------MSNRPR-----------------------PGERVR-LY
Q9GL49_PMAIP1-01        ----QTRREEL---RGSFGPP-------------PAAVRGNQPTSEA-FG
A0A3B4BVX1_BCL2L11      ----QPEPGEGDPVRGGITMP-------------N---------------
A0A3B4BVX1_BCL2L11      ----QPEPGEGDPVRGGITMP-------------N---------------
I3K7B6_BAD-01           ------------SKPQTLALP-------------VIKTT---------VQ
A0A3B4GXJ6_BAD-01       ------------SKPQTLSLP-------------VIKTTAA--GRLR-VN
B5X1T1_BAD-01           ------------FQRHYVSTR-------------T-GIRPRPGGRVR-LY
H3ANP3_BAD-03           ----EPSEKTAGLKKHSRTAP-------------NLQNPGPHQSHPP-SH
H3ANP3_BAD-01           ----EPSEKTAGLKKHSRTAP-------------NLQNPGPHQSHPP-SH
H3ANP3_BAD-02           ----EPSEKTAGLKKHSRTAP-------------NLQNPGPHQSHPP-SH
H3ANP3_BAD-04           ----EPSEKTAGLKKHSRTAP-------------NLQNPGPHQSHPP-SH
H3D8J8_BAD-01           ----SESQASA-VSRDE---------------------------------
A0A3B5L9R9_BAD-01       ----QEKEKPL-SQRHTLTLP-------------ELRSTKV---------
A0A3B1IH05_BAD-01       ---------PS-RSGQHITVP-------------E-----------K-LR
Q4V925_BAD-02           --------------KQHLTVP-------------D-RLKGEQLGRQR---
Q4V925_BAD-03           --------------KQHLTVP-------------D-RLKGEQLGRQR---
A7MCM4_BAD-01           --------------KQHLTVP-------------D-RLKGEQLGRQR---
Q4V925_BAD-04           --------------KQHLTVP-------------D-RLKGEQLGRQR---
Q4V925_BAD-01           --------------KQHLTVP-------------D-RLKGEQLGRQR---
A0A3B3BQF7_BAD-01       ----GGGGGHL-HDRHALTLP-------------ELRLTSN--GRTR-LN
A0A2U9BAC9_BAD-01       --------EQV-PPRHTLALP-------------ELRMAAT--GRIR-LN
A0A3B4VFC5_BAD-01       --------QEL-SQRHTLTLP-------------ELRGAAT--GRTR-LN
A0A3B4W9T1_BAD-01       --------QEL-SQRHTLTLP-------------ELRGAAT--GRTR-LN
A0A3B3QX41_BAD-01       --------LGN-NLK-------------------NTKNPGEAGGRVR-MR
A0A1W4YVX7_BAD-01       --------PAS-QLEHALTVP-------------DIKLSGEPGSRVR-VL
A0A1W4YVX7_BAD-02       --------PAS-QLEHALTVP-------------DIKLSGEPGSRVR-VL
A0A3B5K831_BAD-01       --------RQV-LQRHTLTLP-------------ELRLTGT--SRTR-VS
A0A087X8P8_BAD-01       --------RPL-SQRHTLTLP-------------ELR-STT--GRVR-LN
A0A3B3UA11_BAD-01       --------RPL-SQRHTLTLP-------------ELR-STT--GRVR-LN
A0A3B3YFR1_BAD-01       --------RPL-SQRHTLTLP-------------ELR-STT--GRVR-LN
A0A3B5Q2N7_BAD-01       --------KPL-SQRHTLTLP-------------ELR-STT--GRVR-LN
A0A3B3HDU2_BAD-01       --------EHL-HDRHSLTLP-------------ELRLTSN--GRTR-LN
G3Q8B3_BAD-01           --------QQR-LQRHTLTLP-------------EL----------R-LS
A0A3B5BAL2_BAD-01       --------MHV-FERRNLALP-------------ELRTPAA--GRIR-LN
A0A2D0SYM2_BAD-01       ----NTDSP----------------------------------SVGGRVR
A0A3B4DUY7_BAD-01       ----NGDSPQLDSQHSMASNI-------------SPASPDELSEVGCRVR
A0A2I3HWI8_BBC3-03      ----C-----------------------------------------AGGP
A0A2K6FQZ3_BBC3-04      ----PGPQPSLSLAEQHLESP-------------VPSAP----GALAGGP
Q9BXH1_BBC3-05          ----CGPQPSLSLAEQHLESP-------------VPSAP----GALAGGP
A0A2R9BZA9_BBC3-01      ----CGPQPSLSLAEQHLESP-------------VPSAP----GALAGGP
A0A2I3RGH5_BBC3-03      ----CGPQPSLSLAEQHLESP-------------VPSAP----GALAGGP
A0A2K5P2T8_BBC3-03      ----CGPQPSLLLAEQHLESP-------------VPSAP----GALAGGP
A0A2K5V8J3_BBC3-03      ----CGPQPSLLLAEQHLESP-------------VPSAP----GALAGGP
F7FFP6_BBC3-03          ----CGPQPSLLLAEQHLESP-------------VPSAP----GALAGGP
A0A2K6ASP2_BBC3-03      ----CGPQPSLLLAEQHLESP-------------VPSAP----GALAGGP
A0A2I3N2Z9_BBC3-03      ----CGPQPSLLLAEQHLESP-------------VPSAP----GALAGGP
A0A2K6QZU4_BBC3-04      ----CGPQPSLSLAEQHLESP-------------VPSAP----GALAGGP
A0A2R8MW85_BBC3-03      ----CGPQPSLSLAEQHLESP-------------VPSAP----GALAGGP
A0A2K6STD6_BBC3-02      ----CGSQPSLSLAEQHLESP-------------VPSAP----GALAGGP
G3T2N1_BBC3-01          PRPLSGPQPSLSPAEQHLESP-------------V--------------P
M3Y0R3_BBC3-01          LLF-PGPQPSLSPAEPHLESP-------------VPSAP----GALAGGP
Q99ML1_BBC3-02          PRP-DGPQPSLSPAQQHLESP-------------VPSAP----EALAGGP
Q80ZG6_BBC3-01          PRP-DGPQPSLSPAQQHLESP-------------VPSAP----EALAGGP
H0XQ00_BBC3-01          PRL-DGPQPSLLPAEQHLESP-------------VPSTP----GALAGGP
J9NTK9_BBC3-01          PRP-DGPQPSLSPAEQHLESP-------------VPSAP----GALAGGP
A0A337SQV0_BBC3-02      PRP-DGPQPSLSPAEQHLESP-------------VPSAP----GALAGGP
F1RM01_BBC3-01          PRP-DGPQPSLSPAEQHLESP-------------VPSAP----GALAGGP
A0A2K6FQZ3_BBC3-01      PRP-DGPQPSLSLAEQHLESP-------------VPSAP----GALAGGP
Q9BXH1_BBC3-06          PRP-DGPQPSLSLAEQHLESP-------------VPSAP----GALAGGP
A0A2I3RIG5_BBC3-02      PRP-DGPQPSLSLAEQHLESP-------------VPSAP----GALAGGP
H2NZD3_BBC3-01          PRP-DGPQPSLSLAEQHLESP-------------VPSAP----GALAGGP
A0A2K6QZU4_BBC3-01      PRP-DGPQPSLSLAEQHLESP-------------VPSAP----GALAGGP
A0A0D9S2H2_BBC3-01      PRP-DGPQPSLSLAEQHLESP-------------VPSAP----GALAGGP
B4DQK3_BBC3-01          PRP-DGPQPSLSLAEQHLESP-------------VPSAP----GALAGGP
G1SS60_BAD-01           -----------------------------------PRPK----PLSA-GA
K7E5Y2_BBC3-02          ----PRAYGGPRWARAARS----------------PAAG----NQGQSGS
A0A337SAW2_BAD-01       ----QRTTPGLLGEAGHQQGQ--------------PASS----NHHG-GA
A0A2I3TBK7_BAD-01       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-EG
A0A2R8Z697_BAD-02       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-EG
A0A2I2Z8C7_BAD-03       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-EG
Q92934_BAD-03           ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-EG
A0A2K5M0C1_BAD-02       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GT
A0A2K5XJR2_BAD-02       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GT
A0A2I3MCN5_BAD-03       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GT
A0A2K5VCD8_BAD-02       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GT
F7GVS7_BAD-02           ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GT
A0A2K6E7J3_BAD-02       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GT
A0A2K5E6K7_BAD-02       ----PRQAPGLPGDASHQQGQ--------------PTSS----SHHG-GT
A0A2K6TG62_BAD-02       ----RRQAPGLPGDASHQQGQ--------------PTSS----SHHG-GT
A0A2K5E6K7_BAD-03       ----PRQAPGLPGDASHQQGQ--------------PTSS----SHHG-GE
A0A2K5HKW9_BAD-02       ----HRQAPGLLWDASHQQEQ--------------ATSS----SHHG-GR
A0A2K6N1A1_BAD-02       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GR
A0A2K6PUM5_BAD-02       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GR
A0A2K5M0C1_BAD-03       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GG
A0A2K5VCD8_BAD-03       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GR
F7GVS7_BAD-03           ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GR
A0A2K5XJR2_BAD-03       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GG
A0A2I3MCN5_BAD-02       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GR
A0A2K6E7J3_BAD-03       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GR
A0A2I2Z8C7_BAD-04       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GR
Q92934_BAD-04           ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GR
A0A2I3TBK7_BAD-03       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GR
A0A2R8Z697_BAD-03       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GR
F6SJL0_BAD-02           ----RRQAPGLPGDASHQQGQ--------------STSS----SHHG---
A0A2K6TG62_BAD-03       ----RRQAPGLPGDASHQQGQ--------------PTSS----SHHG---
G1P8C5_BAD-01           ----WSTVPGLLGEAGHQQGQ--------------PASS----SHHD-GA
W5P8G9_BAD-01           ----WLTAPGLLGEAGHQQGQ--------------PAGS----SHHG-GT
G3VRY4_BAD-02           ----HHEKGGAQKSQTHVSKE-------------LKASA----SQGRLGK
G3VRY4_BAD-01           ----HHEGAGAGRPRLISYPP-------------L---------------
I3MBM5_BAD-02           ----CGLAPGLPRDTGHQQWQ--------------ATSS----SNHG-GA
I3MBM5_BAD-01           ----CGLAPGLPRDTGHQQWQ--------------ATSS----SNHG-GA
Q61337_BAD-03           ----PYLAPGLLGSNIHQQGR--------------AATN----SHHG-GA
Q61337_BAD-01           ----PYLAPGLLGSNIHQQGR--------------AATN----SHHG-GA
Q61337_BAD-02           ----PYLAPGLLGSNIHQQGR--------------AATN----SHHG-GA
G3TP47_BAD-01           ----HRVAPGFLRDSSHQQGQ--------------PTSS----GHHG-GA
F7DN67_BAD-01           ----QRTAPGLLGEAGHQQGQ--------------PASS----SHHG-GA
G1MI17_BAD-01           ----RQTAPGLLGEAAHPQGQ--------------PASS----NHHG-GA
A0A287AEF3_BAD-01       ----WRTAPGHLGEAGHQQGQ--------------PASS----SHHG-GA
O35147_BAD-01           ----PYLAPGLLGSIVQQQPG-------------QAANN----SHHG-GA
M3YNE7_BAD-01           ----LQTAPGLLGEAGHQQGQ--------------PASS----SHHG-GA
F1MUT9_BAD-01           ----WLTAPGLLGEAGHQQGQ--------------PAGS----SHHG-GT
Q3SYZ0_BAD-01           ----WLTAPGLLGEAGHQQGQ--------------PAGS----SHHG-GT
H0WVR2_BAD-01           ----RCTTPSLLGDASHLQGQ--------------PASN----THHGAGP
H0V608_BAD-01           ------PAGGFLGDTSHQQRQ-------------LRSSR----SHHG-GT
A0A2K5E6K7_BAD-01       ----PRQAPGLPGDASHQQGQ--------------PTSS----SHHG-GA
A0A2K6TG62_BAD-01       ----RRQAPGLPGDASHQQGQ--------------PTSS----SHHG-GA
A0A0D9R491_BAD-01       ----HHQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2K5M0C1_BAD-01       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2K5VCD8_BAD-01       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
F7GVS7_BAD-01           ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2K6E7J3_BAD-01       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2K5XJR2_BAD-01       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2I3MCN5_BAD-04       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2K6N1A1_BAD-01       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2K6PUM5_BAD-01       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2K5HKW9_BAD-01       ----HRQAPGLLWDASHQQEQ--------------ATSS----SHHG-GA
B4DZQ9_BAD-01           ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2K6GWV0_BAD-01       ----PCTAPSFLGDASHQQGQ--------------PSSS----SHHG-GA
F6SJL0_BAD-01           ----RRQAPGLPGDASHQQGQ--------------STSS----SHHG-GA
A0A2I3MCN5_BAD-01       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2I2Z8C7_BAD-02       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2I2Z8C7_BAD-01       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
Q92934_BAD-01           ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
Q92934_BAD-02           ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2I3TBK7_BAD-02       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2R8Z697_BAD-01       ----HRQAPGLLWDASHQQEQ--------------PTSS----SHHG-GA
A0A2J8TYJ3_BAD-01       ----HRQAPGLLRDASHQQEQ--------------PTSS----SHHG-GA
F1PK10_BAD-01           ----QQTAPGLLGEAGHQQGQ--------------PASR----KHHG-GA
Q45KI9_BAD-01           ----QQTAPGLLGEAGHQQGQ--------------PASR----KHHG-GA
                                                                          

A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          LRRGRARGVAPPLTCSAHLSVSLRRLPPHWGMARAQQDGSSPEPVEGLPR
A9XRH0_BMF-01           VGFALDPNLQEEPQEG--QREARTEVQIARKLQC----------------
R4G9R5_BCL2L11-01       SRWQSRPIPEDMQPEIWIAQELR---RIGDEFNA----------------
A3KND0_BMF-01           FSHCCGPGCRGTDNEDKATQ------TLGSPSQD--------------IM
Q6P7C5_BAD-01           TDRGLGPSLTEDQPGPYLAPG-----LLGSIVQQ----------------
A0A287AEF3_BAD-02       ADRGLGPSPTGTDPQAPASPGARPQATWGKLVTSRGSRPAAATMEALGLW
I3LVX0_BIK-01           ------------MVQGSHQVALRLACIGDEMDLCFQDLQLAQLPGMAMHS
O61667_EGL1-01          SSCEDSSQFADDSGFFDDSEISS---------------------------
A0A286XF37_PMAIP1-      ------------VECAAQLRRVGDTLNSLGCTTEALEVLAEMAGKKARKS
A0A2K5F6X4_BBC3-02      ----GPTQAAPGVRGEEEQWAREI--------------------------
A0A337SQV0_BBC3-03      ----GPTQAAPGVRGEEEQWAREI--------------------------
Q9JM54_PMAIP1-01        PDITVVLAQMPGKSQKSRM--RSPSP---------------------TRV
Q5U777_PMAIP1-01        PDITAVLAQMPGKKSRKSTMRRSPSP---------------------TRV
F1SMU1_PMAIP1-01        AEMPGRRSRRNTQTNPTRVALPPD--------------------------
Q9BXH1_BBC3-04          -------------ACTRPVDVRDSGG------------------------
B2KKY9_BCL2L11-01       FSVDSDSVPGSPLMPNISEAQDG---------QNDEVWLSEH-----SHQ
B8JK68_BCL2L11-01       FSVDSDSVPGSPLMPNISEAQDG---------QNDEVWLSEH-----SHQ
A0A3B3QC78_BCL2L11      HSLDISLPNSPFMTHNKSTQTPSPSN------HLVCIYLSSV--------
A0A2K6KS56_BBC3-02      -----AQYRRR-RQEEQQRHRPSPWR------VLYNLIMGLL-----PLP
F7G1G0_HRK-01           KALGDELQERT-MWRRRARSRRAAAEAAGSGGGGLPAY---W--------
P62816_HRK-03           QALGDELHRRA-M-RRRARP-RDPLP------ALLPALRARW--------
P62817_HRK-01           QALGDELHRRA-M-RRRARP-RDPLP------ALLPALRARW--------
A0A287A5N9_HRK-01       KALGDELHQRT-MWRRSARSRRAPAP------GALPTY---W--------
H2NIS8_HRK-01           KALGDELHQRT-MWRRRARSRRAPAP------SALPTY---W--------
A0A2K5KZ69_HRK-01       KALGDELHQRT-MWRRRARSRRAPAP------GALPTY---W--------
H2Q6Y8_HRK-01           KALGDELHQRT-MWRRRARSRRAPAP------GALPTY---W--------
G3UH24_HRK-01           KALGDELHQRT-MWRRRARSRRAPAP------GALPTY---W--------
A0A2K5BYA0_HRK-01       KALGDELHQRT-MWRRRARSRRAPAP------GALPTY---W--------
U3E722_HRK-01           KALGDELHQRT-MWRRRARSRRAPAP------GALPTY---W--------
A0A0D9SC73_HRK-01       KALGDELHQRT-MWRRRARSRRAPAP------GALPTY---W--------
A0A337SQ56_HRK-01       KALGDELHQRT-MWRRRARSRRAPAP------GALPTY---W--------
G3QTJ6_HRK-01           KALGDELHQRT-MWRRRARSRRAPAP------GALPTY---W--------
O00198_HRK-01           KALGDELHQRT-MWRRRARSRRAPAP------GALPTY---W--------
A0A1D5R1E4_HRK-01       KALGDELHQRT-MWRRRARSRRAPAS------GALPTY---W--------
A0A2K6AYL7_HRK-01       KALGDELHQRT-MWRRRARSRRAPAP------GALPTY---W--------
G1QHD8_HRK-01           KALGDELHQRT-MWRRRARSRRAPAP------GALPTY---W--------
G1T7W1_HRK-01           KALGDELHQRT-MWRRRARSRRAPAP------GALPTY---W--------
H0Y001_HRK-01           KALGDELHQRT-MWRRRARSRRAPAP------GALTTY---W--------
A0A096N944_HRK-01       KALGDELHQRT-MWRRRARSRRAPAP------GALPTY---W--------
A0A2K6GL98_HRK-01       KALGDELHQRT-MWRRRARSRRAPAP------GALTTY---W--------
E2RLD4_HRK-01           KALGDELHQRT-MWRRRARSRRAPAP------RALPTY---W--------
F7GVS7_BAD-04           --FKVSAGPPP-RPPRAGLSLPCPKA------RP-----------DLMSH
Q2PG01_BAD-01           --FK----GLP-RPKSAGTATQMRQS------SSWTRVFQSWWDRNLGRG
A0A2I3H4B2_BAD-01       --FK----GLP-RPKSAGTATQMRQS------SSWTRVFQSWWDRNLGRG
K7GA86_BCL2L11-01       -----DRSPVP-MSCDKSTQTPSPPC------QAFNHYLSAMGKQDHASR
G3SU55_BCL2L11-01       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAINHYLSAM-----ASM
G3W979_BCL2L11-01       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM---DTASM
Q4KMV9_BCL2L11-01       FSF--EVSPGP-VSCDKSTQTPSPPC------QAFNHLLSAM-----ADR
F7FTC8_BCL2L11-01       -----DRSPPP-VSCDKSTQTPSPHC------QAFNHYLSAM-----ASI
A0A2K6E226_BCL2L11      --------------CDKSTQTPSPPC------QAFNHYLSAM-----ASR
M3YDI3_BCL2L11-01       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
F6XMC1_BCL2L11-02       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
F6XMC1_BCL2L11-01       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
F7CXT2_BCL2L11-01       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
O54918_BCL2L11-01       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASI
O88498_BCL2L11-01       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASI
A0A337SW42_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM--------
A0A337SW42_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRA
A0A2K5NU92_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2K5HZI7_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2I2YQ13_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
O43521_BCL2L11-22       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
O43521_BCL2L11-08       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2K5X2I7_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
F7HHA9_BCL2L11-03       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2K6E226_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2K5Z8B6_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2I3HW02_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2R9CA99_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2J8JCT2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2I3M6I1_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2K6KJP8_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2K6QIL2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2K5CAB2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
F6XMC1_BCL2L11-06       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2K6TRZ5_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2K5CAB2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ADW
A0A2K6TRZ5_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ADW
A0A2K5CAB2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
F6XMC1_BCL2L11-04       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
A0A2K6TRZ5_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
A0A2K5NU92_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
A0A2K5HZI7_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
A0A2I2YQ13_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
O43521_BCL2L11-24       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
O43521_BCL2L11-12       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
A0A2K5X2I7_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
F7HHA9_BCL2L11-06       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
A0A2K6E226_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
A0A2K5Z8B6_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
A0A2I3HW02_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
A0A2R9CA99_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
A0A2J8JCT2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
A0A2I3M6I1_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
A0A2K6KJP8_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
A0A2K6QIL2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ANW
A0A2K5NU92_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
A0A2I2YQ13_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
O43521_BCL2L11-21       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
A0A2K5X2I7_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
F7HHA9_BCL2L11-01       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
A0A2K6E226_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
A0A2K5Z8B6_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
A0A2I3HW02_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
A0A2R9CA99_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
A0A2J8JCT2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
A0A2I3M6I1_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
A0A2K6KJP8_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
A0A2K6QIL2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GIF
A0A2K5HZI7_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GVF
A0A2K6GE31_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2K6GE31_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM--------
F6XMC1_BCL2L11-08       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----GYR
A0A2K6GE31_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K6GE31_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A287DFJ0_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A286XJN2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A286XJN2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K5CAB2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
F6XMC1_BCL2L11-07       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K6TRZ5_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
F6XMC1_BCL2L11-05       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K6TRZ5_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K5CAB2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K5NU92_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5HZI7_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5X2I7_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
F7HHA9_BCL2L11-02       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K6E226_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5Z8B6_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2I3M6I1_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K6KJP8_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K6QIL2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2I2YQ13_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
O43521_BCL2L11-16       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
O43521_BCL2L11-09       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2R9CA99_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2J8JCT2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K5NU92_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5HZI7_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5X2I7_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
F7HHA9_BCL2L11-04       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K6E226_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5Z8B6_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2I3M6I1_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K6KJP8_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K6QIL2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2I2YQ13_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
O43521_BCL2L11-18       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2I3HW02_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2R9CA99_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2J8JCT2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K5CAB2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K5CAB2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
F6XMC1_BCL2L11-03       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K6TRZ5_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K6TRZ5_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K6QIL2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K6QIL2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5NU92_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5HZI7_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5X2I7_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K6E226_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K6E226_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5Z8B6_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2I3M6I1_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K6KJP8_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K6KJP8_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2I2YQ13_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
O43521_BCL2L11-03       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2I3HW02_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2R9CA99_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2J8JCT2_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
F1SU81_BCL2L11-02       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A337SW42_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
Q2YDF0_BCL2L11-02       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
W5PY58_BCL2L11-01       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
G1SSY0_BCL2L11-01       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
H0XW23_BCL2L11-01       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A337SW42_BCL2L11      FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
G1LDR8_BCL2L11-01       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
J9NWV6_BCL2L11-01       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
F1SU81_BCL2L11-01       FSFDTDRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
O43521_BCL2L11-11       ---------------------VSLCH------PGWSALVRSW-----LTA
F7HHA9_BCL2L11-08       ---------------------VSLCC------PSWSALVLSW-----LTA
O54918_BCL2L11-08       -----------------------------------------------ASI
O54918_BCL2L11-06       -----------------------------------------------ASI
O54918_BCL2L11-03       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DQL
O43521_BCL2L11-07       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
O43521_BCL2L11-19       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VRE
A0A2I3HW02_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DEA
A0A2K6TRZ5_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DEA
A0A2K5HZI7_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DEA
A0A2K5NU92_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DEA
A0A2K5Z8B6_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DEA
A0A2I2YQ13_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DDS
O43521_BCL2L11-23       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DDS
A0A2R9CA99_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DDS
A0A2J8JCT2_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DDS
F7HHA9_BCL2L11-07       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DEA
A0A2K5CAB2_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DEA
A0A2K5X2I7_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DEA
A0A2I3M6I1_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----DEA
C1KGB8_BCL2L11-01       -----------------------------------------------ASM
A0A2K6GE31_BCL2L11      -----------------------------------------------ASM
A0A337SW42_BCL2L11      -----------------------------------------------ASM
O43521_BCL2L11-10       -----------------------------------------------ASM
O43521_BCL2L11-20       -----------------------------------------------ASM
A0A2I2YQ13_BCL2L11      -----------------------------------------------ASM
O43521_BCL2L11-17       -----------------------------------------------ASM
O43521_BCL2L11-13       -----------------------------------------------ASM
A0A2I3HW02_BCL2L11      -----------------------------------------------ASM
A0A2R9CA99_BCL2L11      -----------------------------------------------ASM
A0A2J8JCT2_BCL2L11      -----------------------------------------------ASM
A0A2K5NU92_BCL2L11      -----------------------------------------------ASR
A0A2K5X2I7_BCL2L11      -----------------------------------------------ASR
F7HHA9_BCL2L11-05       -----------------------------------------------ASR
A0A2K5Z8B6_BCL2L11      -----------------------------------------------ASR
A0A2K5HZI7_BCL2L11      -----------------------------------------------ASR
A0A2K6KJP8_BCL2L11      -----------------------------------------------ASR
A0A2K6QIL2_BCL2L11      -----------------------------------------------ASR
A0A2K5CAB2_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM--------
A0A2K5Z8B6_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
A0A2K6KJP8_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
A0A2K6QIL2_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
F6XMC1_BCL2L11-09       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
A0A2K6TRZ5_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
A0A2K5HZI7_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
A0A2R9CA99_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
A0A2J8JCT2_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
A0A2K5NU92_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
A0A2K5X2I7_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
F7HHA9_BCL2L11-09       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
A0A2K6E226_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
A0A2I3M6I1_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
A0A2I2YQ13_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
O43521_BCL2L11-06       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
O43521_BCL2L11-15       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
A0A2I3HW02_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----VVI
F1SU81_BCL2L11-03       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A0D9RWE0_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
O43521_BCL2L11-05       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
O43521_BCL2L11-25       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
O54918_BCL2L11-05       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASI
O88498_BCL2L11-02       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASI
A0A2K6GE31_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A286XJN2_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A337SW42_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K5CAB2_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K6TRZ5_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2K6QIL2_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5NU92_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5HZI7_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5X2I7_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K6E226_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K5Z8B6_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2I3M6I1_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2I3M6I1_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2K6KJP8_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASR
A0A2I2YQ13_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
O43521_BCL2L11-02       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2R9CA99_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A2J8JCT2_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
H2P5E2_BCL2L11-01       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
Q2YDF0_BCL2L11-01       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
Q2YDF0_BCL2L11-03       -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A287DFJ0_BCL2L11      -----DRSPAP-MSCDKSTQTPSPPC------QAFNHYLSAM-----ASM
A0A3B4B6Y3_BMF-01       ----HCWHTTFRQIKCEDRATQTP---------------GPALAPNKGML
A0A3B1JLM2_BAD-01       ELLEVGGRVRLYSESQVYNINRWEDN------ENQDGASAEDGGVGDGAP
A0A3B4UNJ0_BMF-01       ----TKMNMLRFSENRPEEQAGV---------------------------
Q0GKC7_BMF-01           ----AELLVLAAS---------S-----------RAQPPDVVLRQNVSPM
W5N4P7_BMF-01           ----AAFRLHFPAHFEQGGDEEE-----------ETGEA-----------
A0A3B3RH63_BMF-01       ----AGLRLHFPALSVPGGHPPQ-----------EERQ------------
W5UAU7_BMF-01           ----AGLLLLTPS-------ART-----------NRVEDAMFPENR----
A0A3B1K1X5_BMF-01       ----AGLLLLAPS-------ARS-----------ERVGDAMFREEHRAVE
A0A3B4CNJ8_BMF-01       ----AGLLLLAPS-------VRP-----------EHVEGAMLQEDQLAME
A0A2U9CJH3_BMF-01       ----AGFRLHFPAHFELFGDQEV-----------RGHE-SEEERSGMEQL
A0A3B5KWG6_BMF-01       ----AGDTLHY----------------------------TGGAPNGMEPL
A0A3B3CGR9_BMF-01       ----AGFRLHFPARFELAGDLEA-----------RRHD-REAERGGMERL
A0A3B3I0V9_BMF-04       ----AGFRLHFPARFELAGDLEV-----------RRHD-REAERRGMERL
A0A3B3I0V9_BMF-01       ----AGFRLHFPARFELAGDLEV-----------RRHD-REAERRGMERL
A0A3B3I0V9_BMF-02       ----AGFRLHFPARFELAGDLEV-----------RRHD-REAERRGMERL
A0A3B3I0V9_BMF-03       ----AGFRLHFPARFELAGDLEV-----------RRHD-REAERRGMERL
A0A3B4U5H8_BMF-01       ----AGFRLHFPAHFELVGDQEA-----------RRQG-SGEERNGMEQL
A0A3B4WM88_BMF-01       ----AGFRLHFPAHFELVGDQEA-----------RRQG-SGEERNGMEQL
I3K2D6_BMF-01           ----AGFRLHFPARFELVGDHRA-----------RRQE-IAEQQNSMERL
A0A3B4ETH0_BMF-01       ----AGFRLHFPARFELVGDHRA-----------SRQG-STEQQNSMERL
A0A3B5B8F6_BMF-01       ----AGFRLHFPARFELIGDHQA-----------RQQQGSEMEQNGMEQL
A0A096LRV0_BMF-01       ----AGFRLHFPAHFELVGDFDA-----------RQQE----EQNRMEQL
A0A3B3WU80_BMF-01       ----AGFRLHFPAHFELVGDFDA-----------RQQE----EQNRMEQL
A0A3B5QK08_BMF-02       ----AGFRLHFPAHFELVGDFDA-----------RQQE----EQNRMEQL
A0A3B5QK08_BMF-01       ----AGFRLHFPAHFELVGDFDA-----------RQQE----EQNRMEQL
F6RS78_BIK-01           ----DSVAMRLAFIGD-EMEVRW-----------MLPHIAELPGVAVYSL
A0A2K5JY52_PMAIP1-      -------SSPLALPRGHEEQVQV-----------ARSRVCYSTQEIWRQT
A0A096MPU8_PMAIP1-      ------SSSPLALPRGHEEQVQV-----------ARSRVCYSTQEIWRQT
A0A2K5ZWH1_PMAIP1-      ------SSSPLALPRGHEEQVQV-----------ARSRVCYSTQEIWRQT
A0A2K5VPX2_PMAIP1-      ------SSSPLVLPRGHEEQVQV-----------ARSRVCYSTQEIWRQT
A0A2K6BV75_PMAIP1-      ------SSSPLVLPRGHEEQVQV-----------ARSRVCYSTQEIWRQT
A0A2K6KJF2_PMAIP1-      ------SSSPLALPRGHEEQVQV-----------ARSRVCYSTQEIWRQT
A0A2K6NC45_PMAIP1-      ------SSSPLALPRGHEEQVQV-----------ARSRVCYSTQEIWRQT
Q13794_PMAIP1-02        ----SLSSSPLALPRGHEEQVQV-----------AGSRVCYSTQEIWRQT
A0A2R9AKC9_PMAIP1-      ----S-SSSPLALPRGHEEQAQV-----------AGSRVCYSTQEIWRQT
A0A1D5QGJ8_PMAIP1-      ----S----PLVLPRGHEEQVQV-----------ARSRVCYSTQEIWRQT
A0A2I2YVQ5_PMAIP1-      ----S----PLALPRGHEEQVQV-----------AGSRVCYSTQEIWRQT
A0A2I3SX38_PMAIP1-      ----SLSSWPLALPRGHEEQVQV-----------AGSRVCYSTQEIWRQT
C1C3S9_BAD-01           ----ETRQRTESASEASETDSVG-----------ELQHFRSRSRSAPSSL
A0A3B4CPH6_BAD-01       ----KKYGRQLRKMSD-EFDTLLDKG------MKRVRSAGAARQMHASPS
F6Z067_BAD-01           ----KESRLRTESASE-----SS-----------ETDKVGELHPFRSRS-
M3XHJ5_BCL2L11-01       ----LSKVIALVRWRDRSLLSTL-----------MGGLLLPPSPCPFVTR
W5QCU2_BIK-01           ----HYLAMQLASIAD-EMELRL-----------LLPQFVEPFWMPMYSL
O70337_BIK-04           ----NQVALRLACIGD-EMDLCL-----------RSPRLVQLPGIAIHRL
O70337_BIK-02           ----NQVALRLACIGD-EMDLCL-----------RSPRLVQLPGIAIHRL
O70337_BIK-01           ----NQVALRLACIGD-EMDLCL-----------RSPRLVQLPGIAIHRL
Q925D2_BIK-01           ----NQVALRLACIGD-EMDRCL-----------RSPRLVQLPGIAMHRL
G1TZR9_BIK-01           ----NQVALRLAYIGD-EMDLHV-----------RGLHTGPAAGVAMHS-
H0W025_BIK-01           ----SLVALRLACIGD-EMDLRL-----------RSPRLAQLPGRAVHSL
A0A2K5CLG5_BIK-01       ----DALVLQLACIAD-QMDVSL-----------RARRLAQLYEVAMYSP
F7FUT7_BIK-01           ----DALALQLACIAD-QMDVSL-----------RARRLAQLYEVAMYSP
A0A2K6TBD7_BIK-01       ----DALALQLACIAD-QMDVSL-----------RARRLAQLYEVATYSP
H2P4N6_BIK-01           ----DALALRLACIGD-EMDVSL-----------RAPRRAQLPEVAMHSL
G1S1X2_BIK-01           ----DALAPRLACIGD-EMDVSL-----------RAPRLAQLSEVAMHSL
G3QCT2_BIK-01           ----DALALRLACIGD-EMDVSL-----------RAPRLAQLSEVAMHSL
A0A2R8ZXD2_BIK-01       ----DALALRLACIGD-EMDVSL-----------RAPRLAQLSDVAMHSL
H2QLU7_BIK-01           ----DALALRLACIGD-EMDVSL-----------RAPRLAQLSDVAMHSL
Q13323_BIK-01           ----DALALRLACIGD-EMDVSL-----------RAPRLAQLSEVAMHSL
A0A2K6MCW0_BIK-01       ----DMLALRLACIGD-EMDVSL-----------RAPRLAQLSEVAMHSL
A0A2K6QK74_BIK-01       ----DMLALRLACIGD-EMDVSL-----------RAPRLAQLSEVAMHSL
A0A0D9QZY8_BIK-01       ----DMLALRLACIGD-EMDVSL-----------RAPRLAQLSEVAMHSL
A0A2K5VW94_BIK-01       ----DMLALRLACIGD-EMDVSL-----------RAPRLAQLSEVAMHSL
A0A2K6DBJ4_BIK-01       ----DMLALRLACIGD-EMDVSL-----------RAPRLAQLSEVAMHSL
A0A2K5J4Q7_BIK-01       ----DMLALRLACIGD-EMDVSL-----------RAPRLAQLSEVAMHSL
A0A096NKG5_BIK-01       ----DMLALRLACIGD-EMDVSL-----------RAPRLAQLSEVAMHSL
A0A2K5LDM6_BIK-01       ----DMLALRLACIGD-EMDVSL-----------RAPRLAQLSEVAMHSL
A0A2K5XSA1_BIK-01       ----DMLALRLACIGD-EMDVSL-----------RAPRLAQLSEVAMHSL
F1PUF4_BIK-01           ----DDVAMRLAFIGD-EMEVRW-----------MLPRVGELPGMAMYSL
H0XAE7_BIK-01           ----DQVALRLACIGD-EMDLHL-----------RSPRLAQLSRMTMHSL
A0A2K6FM79_BIK-01       ----DEVALRLACIGD-EMDLCL-----------RSPRLAWLPGMTMHSL
F6RS78_BIK-02           ----GMTELTESSPDSDNRDSVAMRL------AFIGDEMEVRWMLPHIAE
A0A3B1JXK6_BCL2L11      ----PALHNSLLGYQTRSPLFRTLSR------SSSGYFSFDSEPSSPLLM
A0A3B4BVX1_BCL2L11      ----ITMPNSLLGYQSRSPLFRTLSR------SSSGYFSFESEPSSPLVT
F6TGJ4_BMF-01           ----GCR-----GADYEDKATQTL---------------GSPSISQDIML
G1PAU1_BMF-01           ----GLR-----PISQEDKATQTL---------------SPASPSQGVML
A2AV74_BMF-02           ----GLR-----PISQEDKATQTL---------------SPASPSQGVML
A0A286XXB0_BMF-03       ----GLR-----PTSQEDKATQTL---------------SPSSPSQGVML
I3MDS9_BMF-02           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A287AIU8_BMF-05       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A287AIU8_BMF-01       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A287AIU8_BMF-04       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A287AIU8_BMF-03       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A287AIU8_BMF-02       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
W5UEE7_BCL2L11-01       ----GYFSFDSEPSSPLITHSTAT---------------QTPSPSSQV--
H9GL49_BMF-01           ----GSR-----QARQQDKATQTL---------------NPSSSSQDVML
K7FRX2_BMF-01           ----GIR-----HAEQQDKATQTL---------------SPSSSTQDVML
A9XRG9_BMF-02           ----GVR-----HPEQQDKATQTL---------------SPSSSSQDVML
A9XRG9_BMF-01           ----GVR-----HPEQQDKATQTL---------------SPSSSSQDVML
U3JS06_BMF-01           ----GIR-----HPEQQDKATQTL---------------SPSSSSQDVML
H0ZMX5_BMF-01           ----GIR-----HPEQQDKATQTL---------------SPSSSSQDVML
A9XRG9_BMF-03           ----GVR-----HPEQQDKATQTL---------------SPSSSSQDVML
A9XRG9_BMF-04           ----GVR-----HPEQQDKATQTL---------------SPSSSSQDVML
G1NHG8_BMF-01           ----GVR-----HPEQQDKATQTL---------------SPSSSSQDVML
A0A3B4V919_BCL2L11      ----SAK-----PQFERQRRAEPWPP------RLHRRRRARLAAPVQNHS
A0A3B4XZH1_BCL2L11      ----GAK-----PQFERQRRAETIA--------------TSPGNSLGVFQ
A0A337SQV0_BBC3-01      ----RERHGPSTPGGQLPGARRGP---------------GPRRPAPLSPQ
Q9BXH1_BBC3-03          ----RERHGPRTPGGQLPGARRGP---------------GPRRPAPLPAR
A0A2K5KGR6_BMF-01       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2K6FFR1_BMF-02       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
M3WRS0_BMF-02           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2K5E1W9_BMF-02       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
F7HPK0_BMF-02           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2K6TW86_BMF-03       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2K6RAW8_BMF-02       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
G3QIN5_BMF-02           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
Q96LC9_BMF-07           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
Q96LC9_BMF-05           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2R9BS98_BMF-02       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2J8QDD5_BMF-01       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2K5MJY6_BMF-01       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
G7PAW6_BMF-01           ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2K6B5G4_BMF-03       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2K5Z4C3_BMF-02       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A096NTE9_BMF-03       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2I3HD83_BMF-01       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A2AV74_BMF-01           ----GLR-----PISQEDKATQTL---------------SPASPSQGVML
Q8K589_BMF-01           ----GLR-----PVSQEDKATQTL---------------SPASPSQGVML
I3MDS9_BMF-01           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
G3T7Z4_BMF-01           ----GLR-----HTSQEDKATQTL---------------SPASPSQGVML
F6X3N6_BMF-01           ----GLR-----SVGQEDKATQTL---------------SPASPSQGVML
G3WDQ2_BMF-01           ----GLR-----SVGQEDKATQTL---------------SPASPSQGVML
Q96LC9_BMF-06           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
F6TJI0_BMF-02           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
F6TJI0_BMF-01           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A286XXB0_BMF-02       ----GLR-----PTSQEDKATQTL---------------SPSSPSQGVML
J9PB65_BMF-01           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A286XXB0_BMF-01       ----GLR-----PTSQEDKATQTL---------------SPSSPSQGVML
G1SR62_BMF-01           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
Q05KI3_BMF-02           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
Q05KI3_BMF-01           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
W5QFV1_BMF-01           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
M3WRS0_BMF-01           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
M3YAD5_BMF-01           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2U4BC98_BMF-01       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2K6FFR1_BMF-01       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
H0WYH6_BMF-01           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A096NTE9_BMF-01       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2K6L933_BMF-02       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A096NTE9_BMF-02       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2K5MJY6_BMF-02       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2K5KGR6_BMF-02       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
G7PAW6_BMF-02           ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
F7CM09_BMF-02           ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2K6B5G4_BMF-04       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2K6B5G4_BMF-02       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2K6B5G4_BMF-01       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2K5Z4C3_BMF-01       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2K6L933_BMF-01       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2K6L933_BMF-03       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A2K6RAW8_BMF-01       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
A0A0D9R4R5_BMF-01       ----GLR-----PTSQEDKATQTL---------------GPASPSQGVML
F7HPK0_BMF-01           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2K5E1W9_BMF-01       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2K6TW86_BMF-02       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2K6TW86_BMF-01       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
G3QIN5_BMF-01           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
Q96LC9_BMF-02           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
Q96LC9_BMF-01           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
Q96LC9_BMF-04           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
Q96LC9_BMF-03           ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2R9BS98_BMF-01       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2J8QDD5_BMF-02       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A2J8T301_BMF-01       ----GLR-----PTSQEDKATQTL---------------SPASPSQGVML
A0A3B3VNE0_BCL2L11      ----GGG------GGEPDADSPPC---------------SVSPASLDVFR
A0A3B3YII5_BCL2L11      ----GGG------RGEPDSDSPPC---------------SVSPASLDVFR
A0A3B3YII5_BCL2L11      ----GGG------RGEPDSDSPPC---------------SVSPASLDVFR
A0A3B5M375_BCL2L11      ----GEG-----RRGEPDSDSPPC---------------SVSPASLDVFR
A0A3B5QAM1_BCL2L11      ----GGG-----RRGEPDSDSPPC---------------SVSPASLDVFR
A0A3B5QAM1_BCL2L11      ----GGG-----RRGEPDSDSPPC---------------SVSPASLDVFR
E7FBJ6_BAD-01           ----SESQVYT-VSRWQDTETQD--G------ASVE---ENGDGL----P
B5XEF1_BAD-01           ----SESQVRSQVGKREDTEFQDVMT------PTEE---GGGDGA----S
Q9GL49_PMAIP1-01        ----RSGCCFSS--SLPLARFCPTAP------RAACYLQSQGARVR---G
A0A3B4BVX1_BCL2L11      ---------SLLGYQSRSPLFRTLSR------SSSGYFSFESEPSSPLLT
A0A3B4BVX1_BCL2L11      ---------SLLGYQSRSPLFRTLSR------SSSGYFSFESEPSSPLVT
I3K7B6_BAD-01           ----PNQWNALG--MRDE-DLMARGE------DEVC---TPTEGD----P
A0A3B4GXJ6_BAD-01       ----SESHTSSI--ARDE-ELMARGE------DEVC---TPTEGD----P
B5X1T1_BAD-01           ----SESQVCSQVGRRDNTEFQDVMT------PTEE---GGGDGA----P
H3ANP3_BAD-03           ----TGVYGWVK--LRKRNNMEILGR------PSSESQISDSESLDELGP
H3ANP3_BAD-01           ----------T-------DNMEILGR------PSSESQISDSESLDELGP
H3ANP3_BAD-02           ----------T-------DNMEILGR------PSSESQISDSESLDELGP
H3ANP3_BAD-04           ----TVFWGFT-------DNMEILGR------PSSESQISDSESLDELGP
H3D8J8_BAD-01           -------------------ELQGNGD------DEAG---TPTDGA----P
A0A3B5L9R9_BAD-01       -------------------ELQARGE------EEVG---TPTEGF----P
A0A3B1IH05_BAD-01       ----VEPRQRNF--SMNEEALQESGA------GRHED--GARDGD----S
Q4V925_BAD-02           ----------NL--SMNEEDLLETGV------AED----PHMLGD----P
Q4V925_BAD-03           ----------NL--SMNEEDLLETGV------AED----PHMLGD----P
A7MCM4_BAD-01           ----------NL--SMNEEDLLETGV------AED----PHMLGD----P
Q4V925_BAD-04           ----------NL--SMNEEDLLETGV------AED----PHMLGD----P
Q4V925_BAD-01           ----------NL--SMNEEDLLETGV------AED----PHMLGD----P
A0A3B3BQF7_BAD-01       ----SESTVSTY--SRDE-DLPR--E------DEAG---TPTDGL----A
A0A2U9BAC9_BAD-01       ----SESNASTL--SRDE-ELLTRWD------EEAG---TPTDGA----P
A0A3B4VFC5_BAD-01       ----SESHTSTV--SRDE-EFQARGE------EEAG---TPTEGA----P
A0A3B4W9T1_BAD-01       ----SESHTSTV--SRDE-EFQARGE------EEAG---TPTEGA----P
A0A3B3QX41_BAD-01       ----SESQVSSI--RSEDLDFGEGGA------SEEGGGVCPGDGT----P
A0A1W4YVX7_BAD-01       ----SESEVSLG--RSEEPDLNNRAV------SDEGGGGGAGDGT----H
A0A1W4YVX7_BAD-02       ----SESEVSLG--RSEEPDLNNRAV------SDEGGGGGAGDGT----H
A0A3B5K831_BAD-01       ----SESQASTF--SREE-ELQGNVE------DEAG---TPTEGA----P
A0A087X8P8_BAD-01       ----SESIASTI--SREE-ELQARGE------EEVG---TPTEGF----P
A0A3B3UA11_BAD-01       ----SESIASTI--SREE-ELQARGE------EEVG---TPTEGF----P
A0A3B3YFR1_BAD-01       ----SESIASTI--SREE-ELQARGE------EEVG---TPTEGF----P
A0A3B5Q2N7_BAD-01       ----SESIASTI--SREV-ELQARGE------EEVG---TPTEGF----P
A0A3B3HDU2_BAD-01       ----SESTASTY--SRDE-DLAR--E------DEAG---TPTDGL----A
G3Q8B3_BAD-01           ----GRKSQRIV--EKEE-ELWL---------DETG---TPTEGA----P
A0A3B5BAL2_BAD-01       ----SESHATTV--SRDE-ELQARGE------EEAG---TPTDGA----P
A0A2D0SYM2_BAD-01       LYSESQVHTVSRWEDAELQDGISA---------------EESGGASDGAP
A0A3B4DUY7_BAD-01       LYSESQVYTVSRWQDNE--DGLLA---------------ED-GGAGDGAP
A0A2I3HWI8_BBC3-03      --------------TQAAPGVRGE---------------EEQWAREI---
A0A2K6FQZ3_BBC3-04      --------------TQAAPGVRGE---------------EEQWAREI---
Q9BXH1_BBC3-05          --------------TQAAPGVRGE---------------EEQWAREI---
A0A2R9BZA9_BBC3-01      --------------TQAAPGVRGE---------------EEQWAREI---
A0A2I3RGH5_BBC3-03      --------------TQAAPGVRGE---------------EEQWAREI---
A0A2K5P2T8_BBC3-03      --------------TQAAPGVRGE---------------EEQWAREI---
A0A2K5V8J3_BBC3-03      --------------TQAAPGVRGE---------------EEQWAREI---
F7FFP6_BBC3-03          --------------TQAAPGVRGE---------------EEQWAREI---
A0A2K6ASP2_BBC3-03      --------------TQAAPGVRGE---------------EEQWAREI---
A0A2I3N2Z9_BBC3-03      --------------TQAAPGVRGE---------------EEQWAREI---
A0A2K6QZU4_BBC3-04      --------------TQAAPGVRGE---------------EEQWAREI---
A0A2R8MW85_BBC3-03      --------------TQAAPGVRGE---------------EEQWAREI---
A0A2K6STD6_BBC3-02      --------------TQAAPGVRGE---------------EEQWAREI---
G3T2N1_BBC3-01          --------------TQAAPGVRGE---------------DEQWAREI---
M3Y0R3_BBC3-01          --------------TQAAPGVRGE---------------EEQWAREI---
Q99ML1_BBC3-02          --------------TQAAPGVRVE---------------EEEWAREI---
Q80ZG6_BBC3-01          --------------TQAAPGVRVE---------------EEEWAREI---
H0XQ00_BBC3-01          --------------TQAAPEVRGE---------------EEQWAREI---
J9NTK9_BBC3-01          --------------TQAAPGVRGE---------------EEQWAREI---
A0A337SQV0_BBC3-02      --------------TQAAPGVRGE---------------EEQWAREI---
F1RM01_BBC3-01          --------------TQAAPGIRGE---------------EEQWAREI---
A0A2K6FQZ3_BBC3-01      --------------TQAAPGVRGE---------------EEQWAREI---
Q9BXH1_BBC3-06          --------------TQAAPGVRGE---------------EEQWAREI---
A0A2I3RIG5_BBC3-02      --------------TQAAPGVRGE---------------EEQWAREI---
H2NZD3_BBC3-01          --------------TQAAPGVRGE---------------EEQWAREI---
A0A2K6QZU4_BBC3-01      --------------TQAAPGVRGE---------------EEQWAREI---
A0A0D9S2H2_BBC3-01      --------------TQAAPGVRGE---------------EEQWAQEI---
B4DQK3_BBC3-01          --------------TQAAPGVRGE---------------EEQWAREI---
G1SS60_BAD-01           ----GAMETR--SRHSSYPADADD---------------SEGAEEEP-SP
K7E5Y2_BBC3-02          LPSLGPRSAQEEGGQEGEPQGASP---------------MSGGPPGVLGP
A0A337SAW2_BAD-01       ----GAVETR--SRHSSYPAGTEE---------------DEGTEEEEPSP
A0A2I3TBK7_BAD-01       ----T--SSPEERGHSNPDAAKLQ---------------LDASLPVLVGS
A0A2R8Z697_BAD-02       ----T--SSPEERGHSNADAAKLQ---------------LDASLPVLVGS
A0A2I2Z8C7_BAD-03       ----T--SSPEERRHSNADAAKLQ---------------LDASLPVLVGS
Q92934_BAD-03           ----T--SSPEERGHSNADAAKLQ---------------LDASLPVLVGS
A0A2K5M0C1_BAD-02       -------SSPEERGHSDADAAKLQ---------------LDASLPVLVGS
A0A2K5XJR2_BAD-02       -------SSPEERGHSDADAAKLQ---------------LDASLPVLVGS
A0A2I3MCN5_BAD-03       -------SSPEERGHSDADAAKLQ---------------LDASLPVLVGS
A0A2K5VCD8_BAD-02       -------SSPEERGHSDADAAKLQ---------------LDASLPVLVGS
F7GVS7_BAD-02           -------SSPEERGHSDADAAKLQ---------------LDASLPVLVGS
A0A2K6E7J3_BAD-02       -------SSPEERGHSDADAAKLQ---------------LDASLPVLVGS
A0A2K5E6K7_BAD-02       -------SSPEERGHSNADAAKLQ---------------LDASHPVLVGS
A0A2K6TG62_BAD-02       -------SSPEERGHSNADAAKLQ---------------LDASHPVLVGS
A0A2K5E6K7_BAD-03       ------YSTCASASSSENPSARML---------------SKASAGMSAPA
A0A2K5HKW9_BAD-02       ----AWYSPS-ESEDSENPSARML---------------TEASAGMSAPA
A0A2K6N1A1_BAD-02       ----AWYYPA-ESEDSENPSARML---------------AEASAGMSAPA
A0A2K6PUM5_BAD-02       ----AWYYPA-ESEDSENPSARML---------------AEASAGMSAPA
A0A2K5M0C1_BAD-03       ----AWYSPSWESEDSENPSARML---------------AEASARMSAPA
A0A2K5VCD8_BAD-03       ----AWYSPSWESEDSENPSARML---------------AEASARMSAPA
F7GVS7_BAD-03           ----AWYSPSWESEDSENPSARML---------------AEASARMSAPA
A0A2K5XJR2_BAD-03       ----AWYSPSWESEDSENPSARML---------------AEASARMSAPA
A0A2I3MCN5_BAD-02       ----AWYSPSWESEDSENPSARML---------------AEASAPMSAPA
A0A2K6E7J3_BAD-03       ----AWYSPSWESEDSENPSARML---------------AEASARMSAPA
A0A2I2Z8C7_BAD-04       ----TSYSPSWESEDSENPSAGML---------------AEASAGMSAPA
Q92934_BAD-04           ----TSYSPSWESEDSENPSAGML---------------AEASAGMSAPA
A0A2I3TBK7_BAD-03       ----TSYSPSWESEDSENPSAGML---------------AEASAGMSAPA
A0A2R8Z697_BAD-03       ----TSYSPSWESEDSENPSAGML---------------AEASAGMSAPA
F6SJL0_BAD-02           ----------------ENPSVRMF---------------SKASAGMSAPA
A0A2K6TG62_BAD-03       ----------------ENPSAKML---------------SKASAGMSAPA
G1P8C5_BAD-01           ----GSVEPR--SRHSSYPTGTEE---------------DDDTEEGEPSP
W5P8G9_BAD-01           ----GAVETR--SRHSSYPAGPED---------------DEGTEEEDLGP
G3VRY4_BAD-02           ----GSFEGREGSREASPEAEAEA---------------EQSEGEEERGL
G3VRY4_BAD-01           ---------REGSREASPEAEAEA---------------EQSEGEEERGL
I3MBM5_BAD-02           ----GATETR--SRHSSYPADTDL---------------DEGMEEEP-SP
I3MBM5_BAD-01           ----GATETR--SRHSSYPADTDL---------------DEGMEEEP-SP
Q61337_BAD-03           ----GAMETR--SRHSSYPAGTEE---------------DEGMEEEL-SP
Q61337_BAD-01           ----GAMETR--SRHSSYPAGTEE---------------DEGMEEEL-SP
Q61337_BAD-02           ----GAMETR--SRHSSYPAGTEE---------------DEGMEEEL-SP
G3TP47_BAD-01           ----AAVETR--SRHSSYPAGSDE---------------AEGLEEDP-SP
F7DN67_BAD-01           ----GAVETR--SRHSSYPEGTED---------------EGMEGEEP-GP
G1MI17_BAD-01           ----GAVEPR--SRHSSYPAGTEE---------------DEGLEEEELSP
A0A287AEF3_BAD-01       ----GAVETR--SRHSSYPEGTEE---------------DEGTEDEELSP
O35147_BAD-01           ----GTMETR--SRHSSYPAGTEE---------------DEGMEEEL-SP
M3YNE7_BAD-01           ----GAVETR--SRHSSYPAGTEE---------------DEGMEEEELSP
F1MUT9_BAD-01           ----GAVETR--SRHSSYRAGPED---------------NEETEEEDLGP
Q3SYZ0_BAD-01           ----GAVETR--SRHSSYRAGPED---------------NEETEEEDLGP
H0WVR2_BAD-01           ----GAVETR--SRHSSYPAGTEE---------------DEGI-EEP-SP
H0V608_BAD-01           ----VAMETR--SRHRSYPAGTEE---------------EEGMEEEL-SP
A0A2K5E6K7_BAD-01       ----GAVETR--SRHSSYPAGTEE---------------DEGMEEEP-SP
A0A2K6TG62_BAD-01       ----GAVETR--SRHSSYPAGTEG---------------DEGMEEEP-SP
A0A0D9R491_BAD-01       ----GAVETR--SRHSSYPAGTEE---------------DEGMEEEP-SP
A0A2K5M0C1_BAD-01       ----GAVETR--SRHSSYPAGTEE---------------DEGMEEEP-SP
A0A2K5VCD8_BAD-01       ----GAVETR--SRHSSYPAGTEE---------------DEGMEEEP-SP
F7GVS7_BAD-01           ----GAVETR--SRHSSYPAGTEE---------------DEGMEEEP-SP
A0A2K6E7J3_BAD-01       ----GAVETR--SRHSSYPAGTEE---------------DEGMEEEP-SP
A0A2K5XJR2_BAD-01       ----GAVETR--SRHSSYPAGTEE---------------DEGMEEEP-SP
A0A2I3MCN5_BAD-04       ----GAVETR--SRHSSYPAGTEE---------------DEGMEEEP-SP
A0A2K6N1A1_BAD-01       ----GAVETR--SRHSSYPAGTEE---------------DEGMEEEP-SP
A0A2K6PUM5_BAD-01       ----GAVETR--SRHSSYPAGTEE---------------DEGMEEEP-SP
A0A2K5HKW9_BAD-01       ----GAVETR--SRHSSHPAGTEE---------------DEGMEEEP-SP
B4DZQ9_BAD-01           ----GAVEIR--SRHSSYPAGTED---------------DEGMGEEP-SP
A0A2K6GWV0_BAD-01       ----GSVETR--SRHSSYPAGTEE---------------DEGMEEEP-SP
F6SJL0_BAD-01           ----GAVETR--SRHSSYPAGTEE---------------DEGMEEEP-SP
A0A2I3MCN5_BAD-01       ----GAVETR--SRHSSYPAGTEE---------------DEGMEEEP-SP
A0A2I2Z8C7_BAD-02       ----GAVEIR--SRHSSYPAGTED---------------DEGMGEEP-SP
A0A2I2Z8C7_BAD-01       ----GAVEIR--SRHSSYPAGTED---------------DEGMGEEP-SP
Q92934_BAD-01           ----GAVEIR--SRHSSYPAGTED---------------DEGMGEEP-SP
Q92934_BAD-02           ----GAVEIR--SRHSSYPAGTED---------------DEGMGEEP-SP
A0A2I3TBK7_BAD-02       ----GAVEIR--SRHSSYPAGTED---------------DEGMGEEP-SP
A0A2R8Z697_BAD-01       ----GAVEIR--SRHSSYPAGTED---------------DEGMGEEP-SP
A0A2J8TYJ3_BAD-01       ----GAVEIR--SRHSSYPAGTED---------------DEGMGEEP-SP
F1PK10_BAD-01           ----GA-ETR--SRHSSFPAGTDE---------------DEGMEEEELSP
Q45KI9_BAD-01           ----GA-ETR--SRHSSFPAGTDE---------------DEGMEEEELSP
                                                                          

A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          ESPRTFPLGR-----------LMPSAVSCSLCEAGLNPSGDSMCPAPGPA
A9XRH0_BMF-01           ----IADQFH----------------------------------------
R4G9R5_BCL2L11-01       -----SHCPR----------------------------------------
A3KND0_BMF-01           LPCGVSETPQ----------------------------------------
Q6P7C5_BAD-01           QPGQAANNSH----------------------------------------
A0A287AEF3_BAD-02       RPGVATALTQ----------------------------------------
I3LVX0_BIK-01           LALSYSQARV----------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A286XF37_PMAIP1-      SEPDPARARA----------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9JM54_PMAIP1-01        PADLKDECAQ----------------------------------------
Q5U777_PMAIP1-01        PADLKDECDQ----------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
B2KKY9_BCL2L11-01       HLQMAAPVAA----------------------------------------
B8JK68_BCL2L11-01       HLQMAAPVAA----------------------------------------
A0A3B3QC78_BCL2L11      TRTLSMLPDM----------------------------------------
A0A2K6KS56_BBC3-02      RGHRAPEMEP----------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           DPSPTPSCPF----------------------------------------
Q2PG01_BAD-01           SSAPSQ--------------------------------------------
A0A2I3H4B2_BAD-01       SSAPSQ--------------------------------------------
K7GA86_BCL2L11-01       WESPSIREDM----------------------------------------
G3SU55_BCL2L11-01       RQSQALPADL----------------------------------------
G3W979_BCL2L11-01       RQSQSIPADM----------------------------------------
Q4KMV9_BCL2L11-01       N-----PVNQ----------------------------------------
F7FTC8_BCL2L11-01       RQPQSVPEDM----------------------------------------
A0A2K6E226_BCL2L11      R--QAEPADM----------------------------------------
M3YDI3_BCL2L11-01       RQSQAVPADM----------------------------------------
F6XMC1_BCL2L11-02       RQSQAEPAGM----------------------------------------
F6XMC1_BCL2L11-01       RQSQAEPAGM----------------------------------------
F7CXT2_BCL2L11-01       RQSQSIPADM----------------------------------------
O54918_BCL2L11-01       RQSQEEPEDL----------------------------------------
O88498_BCL2L11-01       RQSQEEPEDL----------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      I-------------------------------------------------
A0A2K5NU92_BCL2L11      I-------------------------------------------------
A0A2K5HZI7_BCL2L11      I-------------------------------------------------
A0A2I2YQ13_BCL2L11      I-------------------------------------------------
O43521_BCL2L11-22       I-------------------------------------------------
O43521_BCL2L11-08       I-------------------------------------------------
A0A2K5X2I7_BCL2L11      I-------------------------------------------------
F7HHA9_BCL2L11-03       I-------------------------------------------------
A0A2K6E226_BCL2L11      I-------------------------------------------------
A0A2K5Z8B6_BCL2L11      I-------------------------------------------------
A0A2I3HW02_BCL2L11      I-------------------------------------------------
A0A2R9CA99_BCL2L11      I-------------------------------------------------
A0A2J8JCT2_BCL2L11      I-------------------------------------------------
A0A2I3M6I1_BCL2L11      I-------------------------------------------------
A0A2K6KJP8_BCL2L11      I-------------------------------------------------
A0A2K6QIL2_BCL2L11      I-------------------------------------------------
A0A2K5CAB2_BCL2L11      I-------------------------------------------------
F6XMC1_BCL2L11-06       I-------------------------------------------------
A0A2K6TRZ5_BCL2L11      I-------------------------------------------------
A0A2K5CAB2_BCL2L11      D-------------------------------------------------
A0A2K6TRZ5_BCL2L11      D-------------------------------------------------
A0A2K5CAB2_BCL2L11      E-------------------------------------------------
F6XMC1_BCL2L11-04       E-------------------------------------------------
A0A2K6TRZ5_BCL2L11      E-------------------------------------------------
A0A2K5NU92_BCL2L11      D-------------------------------------------------
A0A2K5HZI7_BCL2L11      D-------------------------------------------------
A0A2I2YQ13_BCL2L11      D-------------------------------------------------
O43521_BCL2L11-24       D-------------------------------------------------
O43521_BCL2L11-12       D-------------------------------------------------
A0A2K5X2I7_BCL2L11      D-------------------------------------------------
F7HHA9_BCL2L11-06       D-------------------------------------------------
A0A2K6E226_BCL2L11      D-------------------------------------------------
A0A2K5Z8B6_BCL2L11      D-------------------------------------------------
A0A2I3HW02_BCL2L11      D-------------------------------------------------
A0A2R9CA99_BCL2L11      D-------------------------------------------------
A0A2J8JCT2_BCL2L11      D-------------------------------------------------
A0A2I3M6I1_BCL2L11      D-------------------------------------------------
A0A2K6KJP8_BCL2L11      D-------------------------------------------------
A0A2K6QIL2_BCL2L11      D-------------------------------------------------
A0A2K5NU92_BCL2L11      E-------------------------------------------------
A0A2I2YQ13_BCL2L11      E-------------------------------------------------
O43521_BCL2L11-21       E-------------------------------------------------
A0A2K5X2I7_BCL2L11      E-------------------------------------------------
F7HHA9_BCL2L11-01       E-------------------------------------------------
A0A2K6E226_BCL2L11      E-------------------------------------------------
A0A2K5Z8B6_BCL2L11      E-------------------------------------------------
A0A2I3HW02_BCL2L11      E-------------------------------------------------
A0A2R9CA99_BCL2L11      E-------------------------------------------------
A0A2J8JCT2_BCL2L11      E-------------------------------------------------
A0A2I3M6I1_BCL2L11      E-------------------------------------------------
A0A2K6KJP8_BCL2L11      E-------------------------------------------------
A0A2K6QIL2_BCL2L11      E-------------------------------------------------
A0A2K5HZI7_BCL2L11      E-------------------------------------------------
A0A2K6GE31_BCL2L11      I-------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       LTGQQPCLPW----------------------------------------
A0A2K6GE31_BCL2L11      RQFQAEPADM----------------------------------------
A0A2K6GE31_BCL2L11      RQFQAEPADM----------------------------------------
A0A287DFJ0_BCL2L11      RESQAEPADM----------------------------------------
A0A286XJN2_BCL2L11      RQSQAGPPHL----------------------------------------
A0A286XJN2_BCL2L11      RQSQAGPPHL----------------------------------------
A0A2K5CAB2_BCL2L11      RQSQAEPAGM----------------------------------------
F6XMC1_BCL2L11-07       RQSQAEPAGM----------------------------------------
A0A2K6TRZ5_BCL2L11      RQSQAEPAGM----------------------------------------
F6XMC1_BCL2L11-05       RQSQAEPAGM----------------------------------------
A0A2K6TRZ5_BCL2L11      RQSQAEPAGM----------------------------------------
A0A2K5CAB2_BCL2L11      RQSQAEPAGM----------------------------------------
A0A2K5NU92_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5HZI7_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5X2I7_BCL2L11      R--QAEPADM----------------------------------------
F7HHA9_BCL2L11-02       R--QAEPADM----------------------------------------
A0A2K6E226_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5Z8B6_BCL2L11      R--QAEPADM----------------------------------------
A0A2I3M6I1_BCL2L11      R--QAEPADM----------------------------------------
A0A2K6KJP8_BCL2L11      R--QAEPADM----------------------------------------
A0A2K6QIL2_BCL2L11      R--QAEPADM----------------------------------------
A0A2I2YQ13_BCL2L11      R--QAEPADM----------------------------------------
O43521_BCL2L11-16       R--QAEPADM----------------------------------------
O43521_BCL2L11-09       R--QAEPADM----------------------------------------
A0A2R9CA99_BCL2L11      R--QAEPADM----------------------------------------
A0A2J8JCT2_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5NU92_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5HZI7_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5X2I7_BCL2L11      R--QAEPADM----------------------------------------
F7HHA9_BCL2L11-04       R--QAEPADM----------------------------------------
A0A2K6E226_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5Z8B6_BCL2L11      R--QAEPADM----------------------------------------
A0A2I3M6I1_BCL2L11      R--QAEPADM----------------------------------------
A0A2K6KJP8_BCL2L11      R--QAEPADM----------------------------------------
A0A2K6QIL2_BCL2L11      R--QAEPADM----------------------------------------
A0A2I2YQ13_BCL2L11      R--QAEPADM----------------------------------------
O43521_BCL2L11-18       R--QAEPADM----------------------------------------
A0A2I3HW02_BCL2L11      R--QAEPADM----------------------------------------
A0A2R9CA99_BCL2L11      R--QAEPADM----------------------------------------
A0A2J8JCT2_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5CAB2_BCL2L11      RQSQAEPAGM----------------------------------------
A0A2K5CAB2_BCL2L11      RQSQAEPAGM----------------------------------------
F6XMC1_BCL2L11-03       RQSQAEPAGM----------------------------------------
A0A2K6TRZ5_BCL2L11      RQSQAEPAGM----------------------------------------
A0A2K6TRZ5_BCL2L11      RQSQAEPAGM----------------------------------------
A0A2K6QIL2_BCL2L11      R--QAEPADM----------------------------------------
A0A2K6QIL2_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5NU92_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5HZI7_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5X2I7_BCL2L11      R--QAEPADM----------------------------------------
A0A2K6E226_BCL2L11      R--QAEPADM----------------------------------------
A0A2K6E226_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5Z8B6_BCL2L11      R--QAEPADM----------------------------------------
A0A2I3M6I1_BCL2L11      R--QAEPADM----------------------------------------
A0A2K6KJP8_BCL2L11      R--QAEPADM----------------------------------------
A0A2K6KJP8_BCL2L11      R--QAEPADM----------------------------------------
A0A2I2YQ13_BCL2L11      R--QAEPADM----------------------------------------
O43521_BCL2L11-03       R--QAEPADM----------------------------------------
A0A2I3HW02_BCL2L11      R--QAEPADM----------------------------------------
A0A2R9CA99_BCL2L11      R--QAEPADM----------------------------------------
A0A2J8JCT2_BCL2L11      R--QAEPADM----------------------------------------
F1SU81_BCL2L11-02       RQSQAEPADM----------------------------------------
A0A337SW42_BCL2L11      RQPQAVPADM----------------------------------------
Q2YDF0_BCL2L11-02       RQSQAVPADT----------------------------------------
W5PY58_BCL2L11-01       RQSQAVPADT----------------------------------------
G1SSY0_BCL2L11-01       RQSQAEPADT----------------------------------------
H0XW23_BCL2L11-01       RQSQAEPADL----------------------------------------
A0A337SW42_BCL2L11      RQPQAVPADM----------------------------------------
G1LDR8_BCL2L11-01       RQSQAVPADM----------------------------------------
J9NWV6_BCL2L11-01       RQSQAVPADM----------------------------------------
F1SU81_BCL2L11-01       RQSQAEPADM----------------------------------------
O43521_BCL2L11-11       TSNSQVQAVL----------------------------------------
F7HHA9_BCL2L11-08       TSNSQVQAVL----------------------------------------
O54918_BCL2L11-08       RQSQEEPEDL----------------------------------------
O54918_BCL2L11-06       RQSQEEPEDL----------------------------------------
O54918_BCL2L11-03       ENLNQVAQNI----------------------------------------
O43521_BCL2L11-07       IE-EVVV-------------------------------------------
O43521_BCL2L11-19       IE-EVVV-------------------------------------------
A0A2I3HW02_BCL2L11      AG-SSL--------------------------------------------
A0A2K6TRZ5_BCL2L11      TG-SSL--AL----------------------------------------
A0A2K5HZI7_BCL2L11      TG-SSLRIAL----------------------------------------
A0A2K5NU92_BCL2L11      TG-SSLRIAL----------------------------------------
A0A2K5Z8B6_BCL2L11      TG-SSLGIAL----------------------------------------
A0A2I2YQ13_BCL2L11      AG-SSLRIAL----------------------------------------
O43521_BCL2L11-23       AG-SSLRIAL----------------------------------------
A0A2R9CA99_BCL2L11      AG-SSLRIAL----------------------------------------
A0A2J8JCT2_BCL2L11      AG-SSLRIAL----------------------------------------
F7HHA9_BCL2L11-07       TG-SSLGIAL----------------------------------------
A0A2K5CAB2_BCL2L11      TE-SSLGIAL----------------------------------------
A0A2K5X2I7_BCL2L11      TG-SSLGIAL----------------------------------------
A0A2I3M6I1_BCL2L11      TG-SSLGIAL----------------------------------------
C1KGB8_BCL2L11-01       RQSQAEPADM----------------------------------------
A0A2K6GE31_BCL2L11      RQFQAEPADM----------------------------------------
A0A337SW42_BCL2L11      RQPQAVPADM----------------------------------------
O43521_BCL2L11-10       RQAE--PADM----------------------------------------
O43521_BCL2L11-20       RQAE--PADM----------------------------------------
A0A2I2YQ13_BCL2L11      RQAE--PADM----------------------------------------
O43521_BCL2L11-17       RQAE--PADM----------------------------------------
O43521_BCL2L11-13       RQAE--PADM----------------------------------------
A0A2I3HW02_BCL2L11      RQAE--PADM----------------------------------------
A0A2R9CA99_BCL2L11      RQAE--PADM----------------------------------------
A0A2J8JCT2_BCL2L11      RQAE--PADM----------------------------------------
A0A2K5NU92_BCL2L11      RQAE--PADM----------------------------------------
A0A2K5X2I7_BCL2L11      RQAE--PADM----------------------------------------
F7HHA9_BCL2L11-05       RQAE--PADM----------------------------------------
A0A2K5Z8B6_BCL2L11      RQAE--PADM----------------------------------------
A0A2K5HZI7_BCL2L11      RQAE--PADM----------------------------------------
A0A2K6KJP8_BCL2L11      RQAE--PADM----------------------------------------
A0A2K6QIL2_BCL2L11      RQAE--PADM----------------------------------------
A0A2K5CAB2_BCL2L11      ----GDISLW----------------------------------------
A0A2K5Z8B6_BCL2L11      LEDIGDSSL-----------------------------------------
A0A2K6KJP8_BCL2L11      LEDIGDTSLW----------------------------------------
A0A2K6QIL2_BCL2L11      LEDIGDTSLW----------------------------------------
F6XMC1_BCL2L11-09       RMDIGDISLW----------------------------------------
A0A2K6TRZ5_BCL2L11      RMDIGDISLW----------------------------------------
A0A2K5HZI7_BCL2L11      LEDIGDTSLW----------------------------------------
A0A2R9CA99_BCL2L11      LEDIGDLSLC----------------------------------------
A0A2J8JCT2_BCL2L11      LEDIGDLSLC----------------------------------------
A0A2K5NU92_BCL2L11      LEDIGDSSLW----------------------------------------
A0A2K5X2I7_BCL2L11      LEDIGDSSLW----------------------------------------
F7HHA9_BCL2L11-09       LEDIGDSSLW----------------------------------------
A0A2K6E226_BCL2L11      LEDIGDSSLW----------------------------------------
A0A2I3M6I1_BCL2L11      LEDIGDSSLW----------------------------------------
A0A2I2YQ13_BCL2L11      LEDIGDLSLW----------------------------------------
O43521_BCL2L11-06       LEDIGDLSLC----------------------------------------
O43521_BCL2L11-15       LEDIGDLSLC----------------------------------------
A0A2I3HW02_BCL2L11      LEDVGDISLW----------------------------------------
F1SU81_BCL2L11-03       RQSQAEPADM----------------------------------------
A0A0D9RWE0_BCL2L11      R--QAEPADM----------------------------------------
O43521_BCL2L11-05       R--QAEPADM----------------------------------------
O43521_BCL2L11-25       R--QAEPADM----------------------------------------
O54918_BCL2L11-05       RQSQEEPEDL----------------------------------------
O88498_BCL2L11-02       RQSQEEPEDL----------------------------------------
A0A2K6GE31_BCL2L11      RQFQAEPADM----------------------------------------
A0A286XJN2_BCL2L11      RQSQAGPPHL----------------------------------------
A0A337SW42_BCL2L11      RQPQAVPADM----------------------------------------
A0A2K5CAB2_BCL2L11      RQSQAEPAGM----------------------------------------
A0A2K6TRZ5_BCL2L11      RQSQAEPAGM----------------------------------------
A0A2K6QIL2_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5NU92_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5HZI7_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5X2I7_BCL2L11      R--QAEPADM----------------------------------------
A0A2K6E226_BCL2L11      R--QAEPADM----------------------------------------
A0A2K5Z8B6_BCL2L11      R--QAEPADM----------------------------------------
A0A2I3M6I1_BCL2L11      R--QAEPADM----------------------------------------
A0A2I3M6I1_BCL2L11      R--QAEPADM----------------------------------------
A0A2K6KJP8_BCL2L11      R--QAEPADM----------------------------------------
A0A2I2YQ13_BCL2L11      R--QAEPADM----------------------------------------
O43521_BCL2L11-02       R--QAEPADM----------------------------------------
A0A2R9CA99_BCL2L11      R--QAEPADM----------------------------------------
A0A2J8JCT2_BCL2L11      R--QAEPADM----------------------------------------
H2P5E2_BCL2L11-01       R--QAEPADM----------------------------------------
Q2YDF0_BCL2L11-01       RQSQAVPADT----------------------------------------
Q2YDF0_BCL2L11-03       RQSQAVPADT----------------------------------------
A0A287DFJ0_BCL2L11      RESQAEPADM----------------------------------------
A0A3B4B6Y3_BMF-01       PCGVAEEPRP----------------------LFYAHFELGEDQEASESL
A0A3B1JLM2_BAD-01       FRGRSQSAPA----------------------ALWKAKKY----------
A0A3B4UNJ0_BMF-01       ---------S----------------------------------------
Q0GKC7_BMF-01           ERPEPRPAQS----------------------------------------
W5N4P7_BMF-01           ---EEQPVRS----------------------------------------
A0A3B3RH63_BMF-01       PD-DRP-QPS----------------------------------------
W5UAU7_BMF-01           PR-RRP-AHS----------------------------------------
A0A3B1K1X5_BMF-01       PR-RRP-AHS----------------------------------------
A0A3B4CNJ8_BMF-01       PR-RRP-PHS----------------------------------------
A0A2U9CJH3_BMF-01       PRQQQPVAHS----------------------------------------
A0A3B5KWG6_BMF-01       PQ-QGPVVRS----------------------------------------
A0A3B3CGR9_BMF-01       PR-QQPAARS----------------------------------------
A0A3B3I0V9_BMF-04       PR-QQPVARS----------------------------------------
A0A3B3I0V9_BMF-01       PR-QQPVARS----------------------------------------
A0A3B3I0V9_BMF-02       PR-QQPVARS----------------------------------------
A0A3B3I0V9_BMF-03       PR-QQPVARS----------------------------------------
A0A3B4U5H8_BMF-01       PR-QQPVARS----------------------------------------
A0A3B4WM88_BMF-01       PR-QQPVARS----------------------------------------
I3K2D6_BMF-01           PR-QRPAARS----------------------------------------
A0A3B4ETH0_BMF-01       PR-QRPAARS----------------------------------------
A0A3B5B8F6_BMF-01       PR-QQPVARS----------------------------------------
A0A096LRV0_BMF-01       PL-HQPAALS----------------------------------------
A0A3B3WU80_BMF-01       PL-HQPAALS----------------------------------------
A0A3B5QK08_BMF-02       PL-HQPAALS----------------------------------------
A0A3B5QK08_BMF-01       PL-HQPAALS----------------------------------------
F6RS78_BIK-01           AFTY---NQT----------------------------------------
A0A2K5JY52_PMAIP1-      ELPAETSESD----------------------------------------
A0A096MPU8_PMAIP1-      ELPAETSESD----------------------------------------
A0A2K5ZWH1_PMAIP1-      ELPAETSESD----------------------------------------
A0A2K5VPX2_PMAIP1-      ELPAETSESD----------------------------------------
A0A2K6BV75_PMAIP1-      KLPAETSESD----------------------------------------
A0A2K6KJF2_PMAIP1-      ELPAETFESD----------------------------------------
A0A2K6NC45_PMAIP1-      ELPAETFESD----------------------------------------
Q13794_PMAIP1-02        ELPAETSESD----------------------------------------
A0A2R9AKC9_PMAIP1-      ELPAETSESD----------------------------------------
A0A1D5QGJ8_PMAIP1-      ELPAETSESD----------------------------------------
A0A2I2YVQ5_PMAIP1-      ELPAETSESD----------------------------------------
A0A2I3SX38_PMAIP1-      ELPAETSESD----------------------------------------
C1C3S9_BAD-01           MVAARYGRE-----------------------------------------
A0A3B4CPH6_BAD-01       WFTFLWSHKE----------------------------------------
F6Z067_BAD-01           -------RSA----------------------------------------
M3XHJ5_BCL2L11-01       SPFFIFMRR-----------------------------------------
W5QCU2_BIK-01           CFPY---SHV----------------------------------------
O70337_BIK-04           AVTY---SRT----------------------------------------
O70337_BIK-02           AVTY---SRT----------------------------------------
O70337_BIK-01           AVTY---SRT----------------------------------------
Q925D2_BIK-01           AATY---SQT----------------------------------------
G1TZR9_BIK-01           -LAFTYSQT-----------------------------------------
H0W025_BIK-01           AITY---SQM----------------------------------------
A0A2K5CLG5_BIK-01       GLAFILDRT-----------------------------------------
F7FUT7_BIK-01           GLAFVLDRT-----------------------------------------
A0A2K6TBD7_BIK-01       GLAFILDRT-----------------------------------------
H2P4N6_BIK-01           GLAFIYDQTE----------------------------------------
G1S1X2_BIK-01           GLAFIYDQTE----------------------------------------
G3QCT2_BIK-01           GLAFIYDQTE----------------------------------------
A0A2R8ZXD2_BIK-01       GLAFIYDQTE----------------------------------------
H2QLU7_BIK-01           GLAFIYDQTE----------------------------------------
Q13323_BIK-01           GLAFIYDQTE----------------------------------------
A0A2K6MCW0_BIK-01       GLAFIYDQTD----------------------------------------
A0A2K6QK74_BIK-01       GLAFIYDQTD----------------------------------------
A0A0D9QZY8_BIK-01       GLAFIYDQTD----------------------------------------
A0A2K5VW94_BIK-01       GLAFIYDQMD----------------------------------------
A0A2K6DBJ4_BIK-01       GLAFIYDQMD----------------------------------------
A0A2K5J4Q7_BIK-01       GLAFIYDQTD----------------------------------------
A0A096NKG5_BIK-01       GLAFIYDQTD----------------------------------------
A0A2K5LDM6_BIK-01       GLAFICDQTD----------------------------------------
A0A2K5XSA1_BIK-01       GLAFIYDQTD----------------------------------------
F1PUF4_BIK-01           A--FTYNQT-----------------------------------------
H0XAE7_BIK-01           G--LSYNQT-----------------------------------------
A0A2K6FM79_BIK-01       GLALSCDQP-----------------------------------------
F6RS78_BIK-02           LPGVAVYSLA----------------------FTYNQTGL----------
A0A3B1JXK6_BCL2L11      HSASTQTPSPSSQVIIHALQRISEARGDAQSFELCPGPNHCPPHRAAAAG
A0A3B4BVX1_BCL2L11      HSASTQTPSPSSQVITHALQRIAEARGNAQTFELWPLYNHHPPHGAAPAG
F6TGJ4_BMF-01           PCGVSETPQR----------------------LFYGHAGYLLYL-PQNSP
G1PAU1_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A2AV74_BMF-02           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A286XXB0_BMF-03       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
I3MDS9_BMF-02           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A287AIU8_BMF-05       PCGVTEEPQR----------------------LFYGNAGYRLPL-PAGFP
A0A287AIU8_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PAGFP
A0A287AIU8_BMF-04       PCGVTEEPQR----------------------LFYGNAGYRLPL-PAGFP
A0A287AIU8_BMF-03       PCGVTEEPQR----------------------LFYGNAGYRLPL-PAGFP
A0A287AIU8_BMF-02       PCGVTEEPQR----------------------LFYGNAGYRLPL-PAGFP
W5UEE7_BCL2L11-01       ---ITHALQR----------------------ISKARGDAQNHELWPALL
H9GL49_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLHVSPIGFS
K7FRX2_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLHEPPVGFA
A9XRG9_BMF-02           PCGVTEEPRR----------------------LFYGNAGYRLHVPPVGFA
A9XRG9_BMF-01           PCGVTEEPRR----------------------LFYGNAGYRLHVPPVGFA
U3JS06_BMF-01           PCGVTEEPRR----------------------LFYGSAGYRLHVPPAGFV
H0ZMX5_BMF-01           PCGVTEEPRR----------------------LFYGSAGYRLHVPPAGFV
A9XRG9_BMF-03           PCGVTEEPRR----------------------LFYGNAGYRLHVPPVGFA
A9XRG9_BMF-04           PCGVTEEPRR----------------------LFYGNAGYRLHVPPVGFA
G1NHG8_BMF-01           PCGVTEEPRR----------------------LFYGNAGYRLHVPPVGFA
A0A3B4V919_BCL2L11      HLSCQHFSRR----------------------SSSGYFSFDSDS-LPSSP
A0A3B4XZH1_BCL2L11      KRSIFSYPRR----------------------SSSGYFSFDSDS-LPTSP
A0A337SQV0_BBC3-01      PPGALGRVLR----------------------PLRARPARRPRR-PRPAA
Q9BXH1_BBC3-03          PPGALGSVLR----------------------PLRARPGCRPRR-PHPAA
A0A2K5KGR6_BMF-01       PCGVTEEPQR----------------------LFYAPAEPKSRV-VADPP
A0A2K6FFR1_BMF-02       PCGVTEEPQR----------------------LFYAPAEPKSHV-VADPP
M3WRS0_BMF-02           PCGVTEEPQR----------------------LFYAPAKPPSSV-VADSP
A0A2K5E1W9_BMF-02       PCGVTEEPQR----------------------LFYASAEPKSRV-VAGPP
F7HPK0_BMF-02           PCGVTEEPQR----------------------LFYAPAEPKSHV-VAGPP
A0A2K6TW86_BMF-03       PCGVTEEPQR----------------------LFYAPAEPKSCV-VAGPP
A0A2K6RAW8_BMF-02       PCGVTEEPQR----------------------LFYAPAEPKSRV-VADPP
G3QIN5_BMF-02           PCGVTEEPQR----------------------LFYAPAEPKSCV-VADPP
Q96LC9_BMF-07           PCGVTEEPQR----------------------LFYAPAEPKSCV-VADPP
Q96LC9_BMF-05           PCGVTEEPQR----------------------LFYAPAEPKSCV-VADPP
A0A2R9BS98_BMF-02       PCGVTEEPQR----------------------LFYAPAEPKSCV-VADPP
A0A2J8QDD5_BMF-01       PCGVTEEPQR----------------------LFYAPAEPKSCV-VADPP
A0A2K5MJY6_BMF-01       PCGVTEEPQR----------------------LFYAPAEPKSRV-VADPP
G7PAW6_BMF-01           PCGVTEEPQR----------------------LFYAPAEPKSRV-VADPP
A0A2K6B5G4_BMF-03       PCGVTEEPQR----------------------LFYAPAEPKSRV-VADPP
A0A2K5Z4C3_BMF-02       PCGVTEEPQR----------------------LFYAPAEPKSRV-VADPP
A0A096NTE9_BMF-03       PCGVTEEPQR----------------------LFYAPAEPKSRV-VADPP
A0A2I3HD83_BMF-01       PCGVTEEPQR----------------------LFYAPAEPKSRV-VADPP
A2AV74_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
Q8K589_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
I3MDS9_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
G3T7Z4_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
F6X3N6_BMF-01           PCGVTEEPHR----------------------LFYGNAGYRLPL-PASFP
G3WDQ2_BMF-01           PCGVTEEPHR----------------------LFYGNAGYRLPL-PANFP
Q96LC9_BMF-06           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
F6TJI0_BMF-02           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
F6TJI0_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A286XXB0_BMF-02       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
J9PB65_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A286XXB0_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
G1SR62_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
Q05KI3_BMF-02           PCGVTEEPQR----------------------LFYGHAGYRLPL-PASFP
Q05KI3_BMF-01           PCGVTEEPQR----------------------LFYGHAGYRLPL-PASFP
W5QFV1_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
M3WRS0_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
M3YAD5_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2U4BC98_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PAGFP
A0A2K6FFR1_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
H0WYH6_BMF-01           PCGVTEEPQR----------------------LFYGNVGYRLPL-PASFP
A0A096NTE9_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2K6L933_BMF-02       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A096NTE9_BMF-02       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2K5MJY6_BMF-02       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2K5KGR6_BMF-02       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
G7PAW6_BMF-02           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
F7CM09_BMF-02           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2K6B5G4_BMF-04       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2K6B5G4_BMF-02       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2K6B5G4_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2K5Z4C3_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2K6L933_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2K6L933_BMF-03       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2K6RAW8_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A0D9R4R5_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
F7HPK0_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2K5E1W9_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2K6TW86_BMF-02       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2K6TW86_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
G3QIN5_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
Q96LC9_BMF-02           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
Q96LC9_BMF-01           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
Q96LC9_BMF-04           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
Q96LC9_BMF-03           PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2R9BS98_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2J8QDD5_BMF-02       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A2J8T301_BMF-01       PCGVTEEPQR----------------------LFYGNAGYRLPL-PASFP
A0A3B3VNE0_BCL2L11      SRSIFRPPRR----------------------SSSGYFSFDCDS-LPSSP
A0A3B3YII5_BCL2L11      SRSIFRPPRR----------------------SSSGYFSFDCDS-LPSSP
A0A3B3YII5_BCL2L11      SRSIFRPPRR----------------------SSSGYFSFDCDS-LPSSP
A0A3B5M375_BCL2L11      SRSIFRPTRR----------------------SSSGYFSFDCDS-LPSSP
A0A3B5QAM1_BCL2L11      SRSIFRPPRR----------------------SSSGYFSFDCDS-LPSSP
A0A3B5QAM1_BCL2L11      SRSIFRPPRR----------------------SSSGYFSFDCDS-LPSSP
E7FBJ6_BAD-01           FRGRSQSAPA----------------------ALWKAKKY----------
B5XEF1_BAD-01           FRGRSQSAPP----------------------ALWAAKKY----------
Q9GL49_PMAIP1-01        LSSRSFAAKF----------------------RLLFAEMP----------
A0A3B4BVX1_BCL2L11      --------SPSLSVCST---------------ELWPLYNHHPPHGAAPAG
A0A3B4BVX1_BCL2L11      HSASTQTPSPSSQVITHALQRIAEARGNAQTFELWPLYNHHPPHGAAPAG
I3K7B6_BAD-01           FRRRSKSAPP----------------------ALWAAKKY----------
A0A3B4GXJ6_BAD-01       FRRRSKSAPP----------------------ALWAAKKY----------
B5X1T1_BAD-01           FRSRSQSAPP----------------------TLWAAKKY----------
H3ANP3_BAD-03           FRTRSRSAPP----------------------NFWAARKY----------
H3ANP3_BAD-01           FRTRSRSAPP----------------------NFWAARKY----------
H3ANP3_BAD-02           FRTRSRSAPP----------------------NFWAARKY----------
H3ANP3_BAD-04           FRTRSRSAPP----------------------NFWAARKY----------
H3D8J8_BAD-01           FRGRSRSAPP----------------------ALWAAKKY----------
A0A3B5L9R9_BAD-01       FRGRSLSAPP----------------------SLWAAKKY----------
A0A3B1IH05_BAD-01       FRRRSRSAPP----------------------SLWAAKKY----------
Q4V925_BAD-02           FRPRSRSAPP----------------------ALWAAKKY----------
Q4V925_BAD-03           FRPRSRSAPP----------------------ALWAAKKY----------
A7MCM4_BAD-01           FRPRSRSAPP----------------------ALWAAKKY----------
Q4V925_BAD-04           FRPRSRSAPP----------------------ALWAAKKY----------
Q4V925_BAD-01           FRPRSRSAPP----------------------ALWAAKKY----------
A0A3B3BQF7_BAD-01       FRGRSKSAPP----------------------ALWAAKKY----------
A0A2U9BAC9_BAD-01       FRGRSKSAPP----------------------ALWAAMKY----------
A0A3B4VFC5_BAD-01       FRGRSKSAPP----------------------ALWAAKKY----------
A0A3B4W9T1_BAD-01       FRGRSKSAPP----------------------ALWAAKKY----------
A0A3B3QX41_BAD-01       FRGRSRSAPP----------------------ALWAAQRY----------
A0A1W4YVX7_BAD-01       FRTRSQSAPP----------------------ALWAAQRY----------
A0A1W4YVX7_BAD-02       FRTRSQSAPP----------------------ALWAAQRY----------
A0A3B5K831_BAD-01       FRGRSRSAPP----------------------ALWAAQRY----------
A0A087X8P8_BAD-01       FRGRSNSAPP----------------------SLWAAKKY----------
A0A3B3UA11_BAD-01       FRGRSNSAPP----------------------SLWAAKKY----------
A0A3B3YFR1_BAD-01       FRGRSNSAPP----------------------SLWAAKKY----------
A0A3B5Q2N7_BAD-01       FRGRSLSAPP----------------------SLWAAKKY----------
A0A3B3HDU2_BAD-01       FRGRSKSAPP----------------------ALWAAKKY----------
G3Q8B3_BAD-01           FRVRSKSAPP----------------------ALWAAKKY----------
A0A3B5BAL2_BAD-01       FRGRSKSAPP----------------------ALWAAKKY----------
A0A2D0SYM2_BAD-01       FRGRSQSAPA----------------------ALWKAKKY----------
A0A3B4DUY7_BAD-01       FRGRSQSAPA----------------------ALWKAKKY----------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
G1SS60_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
K7E5Y2_BBC3-02          EHGDQGEQQ---------------------------DREI----------
A0A337SAW2_BAD-01       FRGRSRSAPP----------------------NLWAALRY----------
A0A2I3TBK7_BAD-01       ELGQG---------------------------------------------
A0A2R8Z697_BAD-02       ELGQG---------------------------------------------
A0A2I2Z8C7_BAD-03       ELGQG---------------------------------------------
Q92934_BAD-03           ELGQG---------------------------------------------
A0A2K5M0C1_BAD-02       ELGQG---------------------------------------------
A0A2K5XJR2_BAD-02       ELGQG---------------------------------------------
A0A2I3MCN5_BAD-03       ELGQG---------------------------------------------
A0A2K5VCD8_BAD-02       ELGQG---------------------------------------------
F7GVS7_BAD-02           ELGQG---------------------------------------------
A0A2K6E7J3_BAD-02       ELGQG---------------------------------------------
A0A2K5E6K7_BAD-02       ELGQG---------------------------------------------
A0A2K6TG62_BAD-02       ELGQG---------------------------------------------
A0A2K5E6K7_BAD-03       TDS-----E-----------------------------------------
A0A2K5HKW9_BAD-02       TDSEAQHAE-----------------------------------------
A0A2K6N1A1_BAD-02       TDSEAQLAE-----------------------------------------
A0A2K6PUM5_BAD-02       TDSEAQLAE-----------------------------------------
A0A2K5M0C1_BAD-03       TDSEAQHAE-----------------------------------------
A0A2K5VCD8_BAD-03       TDSEAQHAE-----------------------------------------
F7GVS7_BAD-03           TDSEAQHAE-----------------------------------------
A0A2K5XJR2_BAD-03       TDSEAQLAE-----------------------------------------
A0A2I3MCN5_BAD-02       TDSEAQHAE-----------------------------------------
A0A2K6E7J3_BAD-03       TDSEAQHAE-----------------------------------------
A0A2I2Z8C7_BAD-04       ADSEAQHAE-----------------------------------------
Q92934_BAD-04           ADSEAQHAE-----------------------------------------
A0A2I3TBK7_BAD-03       ADSEAQHAE-----------------------------------------
A0A2R8Z697_BAD-03       ADSEAQHAE-----------------------------------------
F6SJL0_BAD-02           TDSEAQHTE-----------------------------------------
A0A2K6TG62_BAD-03       TDSEAQHTE-----------------------------------------
G1P8C5_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
W5P8G9_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
G3VRY4_BAD-02           FRGRSSSAPP----------------------ILWAARHY----------
G3VRY4_BAD-01           FRGRSSSAPP----------------------ILWAARHY----------
I3MBM5_BAD-02           FRGRSRSAPP----------------------NLWAAQRY----------
I3MBM5_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
Q61337_BAD-03           FRGRSRSAPP----------------------NLWAAQRY----------
Q61337_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
Q61337_BAD-02           FRGRSRSAPP----------------------NLWAAQRY----------
G3TP47_BAD-01           FRGRSLSAPP----------------------NLWAAQRY----------
F7DN67_BAD-01           FRGRSRSAPP----------------------NLWAARRY----------
G1MI17_BAD-01           FRGRSSSAPP----------------------NLCAALRY----------
A0A287AEF3_BAD-01       FRGRSLSAPP----------------------ILWAAQRY----------
O35147_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
M3YNE7_BAD-01           FRGRSRSAPP----------------------NLCAALRY----------
F1MUT9_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
Q3SYZ0_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
H0WVR2_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
H0V608_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
A0A2K5E6K7_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
A0A2K6TG62_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
A0A0D9R491_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
A0A2K5M0C1_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
A0A2K5VCD8_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
F7GVS7_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
A0A2K6E7J3_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
A0A2K5XJR2_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
A0A2I3MCN5_BAD-04       FRGRSRSAPP----------------------NLWAAQRY----------
A0A2K6N1A1_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
A0A2K6PUM5_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
A0A2K5HKW9_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
B4DZQ9_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
A0A2K6GWV0_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
F6SJL0_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
A0A2I3MCN5_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
A0A2I2Z8C7_BAD-02       FRGRSRSAPP----------------------NLWAAQRY----------
A0A2I2Z8C7_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
Q92934_BAD-01           FRGRSRSAPP----------------------NLWAAQRY----------
Q92934_BAD-02           FRGRSRSAPP----------------------NLWAAQRY----------
A0A2I3TBK7_BAD-02       FRGRSRSAPP----------------------NLWAAQRY----------
A0A2R8Z697_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
A0A2J8TYJ3_BAD-01       FRGRSRSAPP----------------------NLWAAQRY----------
F1PK10_BAD-01           FRGRSSSAPP----------------------NLCAARRY----------
Q45KI9_BAD-01           FRGRSSSAPP----------------------NLCAARRY----------
                                                                          

A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          LAPSSLLPLAYFCTRQPRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRS
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
Q4KMV9_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-03       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-02       --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-03       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A3B4B6Y3_BMF-01       QEGEMQNGREPLPRHPVAVRS-----------------------------
A0A3B1JLM2_BAD-01       --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5UAU7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3B5KWG6_BMF-01       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-04       --------------------------------------------------
A0A3B3I0V9_BMF-01       --------------------------------------------------
A0A3B3I0V9_BMF-02       --------------------------------------------------
A0A3B3I0V9_BMF-03       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
F6RS78_BIK-01           --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
F6Z067_BAD-01           --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
F1PUF4_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
F6RS78_BIK-02           --------------------------------------------------
A0A3B1JXK6_BCL2L11      ----------------------DMQA------------------------
A0A3B4BVX1_BCL2L11      ----------------------DMRP------------------------
F6TGJ4_BMF-01           -------A--RFGEEVDNRRQ-EQSA------------------------
G1PAU1_BMF-01           -------AGSPLGEQPPEGQWQHHRA------------------------
A2AV74_BMF-02           -------AGSPLGEQPPEGQFLQHRA------------------------
A0A286XXB0_BMF-03       -------AGLPLGEQPPEGQW-QHRA------------------------
I3MDS9_BMF-02           -------AGLPLGEQPPEGQW-QHRA------------------------
A0A287AIU8_BMF-05       -------AGLPLGEQPPEGQW-QHRA------------------------
A0A287AIU8_BMF-01       -------AGLPLGEQPPEGQW-QHRA------------------------
A0A287AIU8_BMF-04       -------AGLPLGEQPPEGQW-QHRA------------------------
A0A287AIU8_BMF-03       -------AGLPLGEQPPEGQW-QHRA------------------------
A0A287AIU8_BMF-02       -------AGLPLGEQPPEGQW-QHRA------------------------
W5UEE7_BCL2L11-01       -------NHYPPHGAASAG---DMQA------------------------
H9GL49_BMF-01           -------LNPHFQEEPQESPQ-ELRT------------------------
K7FRX2_BMF-01           -------LNPHLQEEPREGHQ-EARA------------------------
A9XRG9_BMF-02           -------LDPNLQEEPQEGQR-EART------------------------
A9XRG9_BMF-01           -------LDPNLQEEPQEGQR-EART------------------------
U3JS06_BMF-01           -------LDPHLQEEPQEGQR-EARA------------------------
H0ZMX5_BMF-01           -------LDPHLQEEPQEGQR-EARA------------------------
A9XRG9_BMF-03           -------LDPNLQEEPQEGQR-EART------------------------
A9XRG9_BMF-04           -------LDPNLQEEPQEGQR-EART------------------------
G1NHG8_BMF-01           -------LDPNLQEEPQEGQR-EART------------------------
A0A3B4V919_BCL2L11      LSPRPATVERTTQTPSPTSQVMKHAL------------------------
A0A3B4XZH1_BCL2L11      LSPRPATAERTTQTPSPTSQVMKHAL------------------------
A0A337SQV0_BBC3-01      -------RRLPLRPHRPAR---RHRRPGGPPLAWGSPQPAPRAAPRRSSA
Q9BXH1_BBC3-03          -------RCLPLRPHRPTR---RHRRPGGFPLAWGSPQPAPRPAPGRSSA
A0A2K5KGR6_BMF-01       -------L-------PAQPCF-EWRR------------------------
A0A2K6FFR1_BMF-02       -------L-------PTQPCF-ERRR------------------------
M3WRS0_BMF-02           -------L-------PTQPGF-ECRR------------------------
A0A2K5E1W9_BMF-02       -------L-------SAQPGF-EWRR------------------------
F7HPK0_BMF-02           -------L-------PAQPGF-EWRR------------------------
A0A2K6TW86_BMF-03       -------L-------PAQPGF-EWRR------------------------
A0A2K6RAW8_BMF-02       -------L-------PAQPCF-EWRR------------------------
G3QIN5_BMF-02           -------L-------PAQPCF-EWRR------------------------
Q96LC9_BMF-07           -------L-------PAQPCF-EWRR------------------------
Q96LC9_BMF-05           -------L-------PAQPCF-EWRR------------------------
A0A2R9BS98_BMF-02       -------L-------PAQPCF-EWRR------------------------
A0A2J8QDD5_BMF-01       -------L-------PAQPCF-EWRR------------------------
A0A2K5MJY6_BMF-01       -------L-------PAQPCF-EWRR------------------------
G7PAW6_BMF-01           -------L-------PAQPCF-EWRR------------------------
A0A2K6B5G4_BMF-03       -------L-------PAQPCF-EWRR------------------------
A0A2K5Z4C3_BMF-02       -------L-------PAQPCF-EWRR------------------------
A0A096NTE9_BMF-03       -------L-------PAQPCF-EWRR------------------------
A0A2I3HD83_BMF-01       -------L-------PAQPCF-EWRR------------------------
A2AV74_BMF-01           -------AGSPLGEQPPEGQFLQHRA------------------------
Q8K589_BMF-01           -------AGSALGEQPPEGQFLQHRA------------------------
I3MDS9_BMF-01           -------AGLPLGEQPPEGQW-QHRA------------------------
G3T7Z4_BMF-01           -------AGLPLGEQPPEGQW-QHRA------------------------
F6X3N6_BMF-01           -------ASLRLGEEPPEEQW-EHRA------------------------
G3WDQ2_BMF-01           -------SSLRLGAEPPEEQW-EHRA------------------------
Q96LC9_BMF-06           -------AVLPIGEQPPEGQW-QHQA------------------------
F6TJI0_BMF-02           -------AGLPLGEQPPEGQW-QHRA------------------------
F6TJI0_BMF-01           -------AGLPLGEQPPEGQW-QHRA------------------------
A0A286XXB0_BMF-02       -------AGLPLGEQPPEGQW-QHRA------------------------
J9PB65_BMF-01           -------AGLPLLEQPPEGQW-QHRA------------------------
A0A286XXB0_BMF-01       -------AGLPLGEQPPEGQW-QHRA------------------------
G1SR62_BMF-01           -------ANFALGEQPPEGQW-QHRA------------------------
Q05KI3_BMF-02           -------AGLPLGEQPPEGQW-QHRA------------------------
Q05KI3_BMF-01           -------AGLPLGEQPPEGQW-QHRA------------------------
W5QFV1_BMF-01           -------AGLPLGEQPPEGQW-QHRA------------------------
M3WRS0_BMF-01           -------AGLPLGEQPPEGHW-QHRA------------------------
M3YAD5_BMF-01           -------AGLPLGDQPPEGQW-QHRA------------------------
A0A2U4BC98_BMF-01       -------AGLPLGEQPAEGQW-QHRA------------------------
A0A2K6FFR1_BMF-01       -------AGLPLGEQPAEGQW-QHRA------------------------
H0WYH6_BMF-01           -------AGLPIGEQPPEGQW-QHRA------------------------
A0A096NTE9_BMF-01       -------AVLPIGEQPPEGQW-QHRA------------------------
A0A2K6L933_BMF-02       -------AVLPIGEQPPEGQW-QHRA------------------------
A0A096NTE9_BMF-02       -------AVLPIGEQPPEGQW-QHRA------------------------
A0A2K5MJY6_BMF-02       -------AVLPIGEQPPEGQW-QHRA------------------------
A0A2K5KGR6_BMF-02       -------AVLPIGEQPPEGQW-QHRA------------------------
G7PAW6_BMF-02           -------AVLPIGEQPPEGQW-QHRA------------------------
F7CM09_BMF-02           -------AVLPIGEQPPEGQW-QHRA------------------------
A0A2K6B5G4_BMF-04       -------AVLPIGEQPPEGQW-QHRA------------------------
A0A2K6B5G4_BMF-02       -------AVLPIGEQPPEGQW-QHRA------------------------
A0A2K6B5G4_BMF-01       -------AVLPIGEQPPEGQW-QHRA------------------------
A0A2K5Z4C3_BMF-01       -------AVLPIGEQPPEGQW-QHRA------------------------
A0A2K6L933_BMF-01       -------AVLPIGEQPPEGQW-QHRA------------------------
A0A2K6L933_BMF-03       -------AVLPIGEQPPEGQW-QHRA------------------------
A0A2K6RAW8_BMF-01       -------AVLPIGEQPPEGQW-QHRA------------------------
A0A0D9R4R5_BMF-01       -------AVLPIGEQPPEGQW-QHRA------------------------
F7HPK0_BMF-01           -------AVLPLGEQPPEGQW-QHRA------------------------
A0A2K5E1W9_BMF-01       -------AVLPLGEQPPEGQW-QHRA------------------------
A0A2K6TW86_BMF-02       -------AVLPLGEQPPEGQW-QHRA------------------------
A0A2K6TW86_BMF-01       -------AVLPLGEQPPEGQW-QHRA------------------------
G3QIN5_BMF-01           -------AVLPIGEQPPEGQW-QHRA------------------------
Q96LC9_BMF-02           -------AVLPIGEQPPEGQW-QHQA------------------------
Q96LC9_BMF-01           -------AVLPIGEQPPEGQW-QHQA------------------------
Q96LC9_BMF-04           -------AVLPIGEQPPEGQW-QHQA------------------------
Q96LC9_BMF-03           -------AVLPIGEQPPEGQW-QHQA------------------------
A0A2R9BS98_BMF-01       -------AVLPIGEQPPEGQW-QHRA------------------------
A0A2J8QDD5_BMF-02       -------AVLPIGEQPPEGQW-QHRA------------------------
A0A2J8T301_BMF-01       -------AVLPTGEQPPEGQW-QHRA------------------------
A0A3B3VNE0_BCL2L11      LSPHPVTADKATQTPSPTGQVMNHAL------------------------
A0A3B3YII5_BCL2L11      LSPHPVTADKATQTPSPTGQVMNHAL------------------------
A0A3B3YII5_BCL2L11      LSPHPVTADKATQTPSPTGQVMNHAL------------------------
A0A3B5M375_BCL2L11      LSPHPVTADKATQTPSLTGQVMNHAL------------------------
A0A3B5QAM1_BCL2L11      LSPHPVTADKATQTPSLTGQVMNHAL------------------------
A0A3B5QAM1_BCL2L11      LSPHPVTADKATQTPSLTGQVMNHAL------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B4BVX1_BCL2L11      ----------------------DMRP------------------------
A0A3B4BVX1_BCL2L11      ----------------------DMRP------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A1W4YVX7_BAD-01       --------------------------------------------------
A0A1W4YVX7_BAD-02       --------------------------------------------------
A0A3B5K831_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A2D0SYM2_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
G1SS60_BAD-01           --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z697_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0C1_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2I3MCN5_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-02       --------------------------------------------------
F7GVS7_BAD-02           --------------------------------------------------
A0A2K6E7J3_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-03       --------------------------------------------------
A0A2K5HKW9_BAD-02       --------------------------------------------------
A0A2K6N1A1_BAD-02       --------------------------------------------------
A0A2K6PUM5_BAD-02       --------------------------------------------------
A0A2K5M0C1_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-03       --------------------------------------------------
F7GVS7_BAD-03           --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2I3MCN5_BAD-02       --------------------------------------------------
A0A2K6E7J3_BAD-03       --------------------------------------------------
A0A2I2Z8C7_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z697_BAD-03       --------------------------------------------------
F6SJL0_BAD-02           --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3VRY4_BAD-02           --------------------------------------------------
G3VRY4_BAD-01           --------------------------------------------------
I3MBM5_BAD-02           --------------------------------------------------
I3MBM5_BAD-01           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
Q61337_BAD-02           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
O35147_BAD-01           --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A2K5E6K7_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5M0C1_BAD-01       --------------------------------------------------
A0A2K5VCD8_BAD-01       --------------------------------------------------
F7GVS7_BAD-01           --------------------------------------------------
A0A2K6E7J3_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2I3MCN5_BAD-04       --------------------------------------------------
A0A2K6N1A1_BAD-01       --------------------------------------------------
A0A2K6PUM5_BAD-01       --------------------------------------------------
A0A2K5HKW9_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F6SJL0_BAD-01           --------------------------------------------------
A0A2I3MCN5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z697_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
                                                                          

A0A0P0HZF9_PMAIP1-      -----------------------------------AVVECAQQLRTIGDL
Q0GKC8_PMAIP1-01        -----------------------------------AVVECAQQLRNIGDL
A0A3B5RFA9_PMAIP1-      -----------------------------------AAELCARELRQVGDK
U3IW89_BCL2L11-01       -----------------------------------SSGYFSFEAERSPAP
Q6JTU4_BCL2L11-01       -----------------------------------PEIWIAQELRRIGDE
A0A2I3HX97_PMAIP1-      -------------------------------------VECATQLRRFGDK
A0A1D5PAR2_PMAIP1-      -----------------------------------AVAECALELRRIGDK
A0A2K6EM90_PMAIP1-      -------------------------------------EECALQLRRLGDK
G1P8F9_PMAIP1-01        -------------------------------------IECALQLRRIGDK
G3T0P7_PMAIP1-01        -----------------------------------DVVECAIQLRRIGDK
Q1PCT2_PMAIP1-01        -------------------------------------VECAIQLRKFGDK
G1LIZ7_PMAIP1-01        -------------------------------------VECAIQLRRFGDK
A0A2K5NJZ2_PMAIP1-      -------------------------------------VECATQLRRFGDK
A0A0D9S003_PMAIP1-      -------------------------------------VECATQLRRFGDK
A0A2K5VPX2_PMAIP1-      -------------------------------------VECATQLRRFGDK
A0A2K6BV75_PMAIP1-      -------------------------------------VECATQLRRFGDK
A0A2K5ZWH1_PMAIP1-      -------------------------------------VECATQLRRFGDK
A0A096MPU8_PMAIP1-      -------------------------------------VECATQLRRFGDK
A0A2K5JY52_PMAIP1-      -------------------------------------VECATQLRRFGDK
A0A2K6KJF2_PMAIP1-      -------------------------------------VECATQLRRFGDK
A0A2K6NC45_PMAIP1-      -------------------------------------VECATQLRRFGDK
A0A2K6S6C4_PMAIP1-      -------------------------------------VECAIQLRRFGDK
A0A2I2YVQ5_PMAIP1-      -------------------------------------VECATQLRRFGDK
Q13794_PMAIP1-01        -------------------------------------VECATQLRRFGDK
A0A2R9AKC9_PMAIP1-      -------------------------------------VECATQLRRFGDK
A0A2I3SX38_PMAIP1-      -------------------------------------VECATQLRRFGDK
H2NWG2_PMAIP1-01        -------------------------------------VECATQLRRFGDK
A0A2K5CFK7_PMAIP1-      -------------------------------------VECATQLRRFGDK
F7GW45_PMAIP1-01        -------------------------------------VECATQLRRFGDK
A0A337SUX1_PMAIP1-      -------------------------------------VECAMQLRRFGDK
W5P738_PMAIP1-01        -------------------------------------VECAIQLRRIGDK
A0A287AZR7_PMAIP1-      -----------------------------------PAVKCRIGLRRVGTK
G1MV54_BCL2L11-01       -----------------------------------PEIWIAQELRRIGDE
G1PDJ5_BCL2L11-01       -----------------------------------PEMWIAQELRRIGDE
K7E5Y2_BBC3-01          AQEEGGQEGEPQGASPMSGGPPGVLGPEHGDQGEQQDREIGAQLRRMADD
A9XRH0_BMF-01           -----------------------------------RLHIQRHQQNRN---
R4G9R5_BCL2L11-01       -----------------------------------RGFLDYQAVNHQ--I
A3KND0_BMF-01           -----------------------------------RLFYGKEALSEIYRM
Q6P7C5_BAD-01           -----------------------------------H---GGRFLTSI--I
A0A287AEF3_BAD-02       -----------------------------------R---GPRRMKGL--R
I3LVX0_BIK-01           ----------------------------------------TGVLRSLAQG
O61667_EGL1-01          -----------------------------------IGYEIGSKLAAMCDD
A0A286XF37_PMAIP1-      ----------------------------------ELEVECAAQLRRIGDK
A0A2K5F6X4_BBC3-02      ----------------------------------------GAQLRRMADD
A0A337SQV0_BBC3-03      ----------------------------------------GAQLRRMADD
Q9JM54_PMAIP1-01        -------------------------------------------LRRIGDK
Q5U777_PMAIP1-01        -------------------------------------------LRRIGDK
F1SMU1_PMAIP1-01        -----------------------------------PEVECAIQFRRIGDK
Q9BXH1_BBC3-04          -----------------------------------RPLPPPDTLASAGDF
B2KKY9_BCL2L11-01       ---------------------------------LPPEMVVARELRRIGDE
B8JK68_BCL2L11-01       ---------------------------------LPPEMVVARELRRIGDE
A0A3B3QC78_BCL2L11      ---------------------------------R-PEMLVARELRRIGDK
A0A2K6KS56_BBC3-02      ---------------------------------N----------------
F7G1G0_HRK-01           -----------------------------------AWLCAAAHVAALAA-
P62816_HRK-03           -----------------------------------PWLCAAAQVAALAA-
P62817_HRK-01           -----------------------------------PWLCAAAQVAALAA-
A0A287A5N9_HRK-01       -----------------------------------PWLCAAAQVAALAA-
H2NIS8_HRK-01           -----------------------------------PWLCAAAQVAALAA-
A0A2K5KZ69_HRK-01       -----------------------------------PWLCAAAQVAALAA-
H2Q6Y8_HRK-01           -----------------------------------PWLCAAAQVAALAA-
G3UH24_HRK-01           -----------------------------------PWLCAAAQVAALAA-
A0A2K5BYA0_HRK-01       -----------------------------------PWLCAAAQVAALAA-
U3E722_HRK-01           -----------------------------------PWLCAAAQVAALAA-
A0A0D9SC73_HRK-01       -----------------------------------PWLCAAAQVAALAA-
A0A337SQ56_HRK-01       -----------------------------------PWLCAAAQVAALAA-
G3QTJ6_HRK-01           -----------------------------------PWLCAAAQVAALAA-
O00198_HRK-01           -----------------------------------PWLCAAAQVAALAA-
A0A1D5R1E4_HRK-01       -----------------------------------PWLCAAAQVAALAA-
A0A2K6AYL7_HRK-01       -----------------------------------PWLCAAAQVAALAA-
G1QHD8_HRK-01           -----------------------------------PWLCAAAQVAALAA-
G1T7W1_HRK-01           -----------------------------------PWLCAAAQVAALAA-
H0Y001_HRK-01           -----------------------------------PWLCAAAQVAALAA-
A0A096N944_HRK-01       -----------------------------------PWLCAAAQVAALAA-
A0A2K6GL98_HRK-01       -----------------------------------PWLCAAAQVAALAA-
E2RLD4_HRK-01           -----------------------------------PWLCAAAQVAALAA-
F7GVS7_BAD-04           ---------------------------------LAP--------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       ---------------------------------Q-PEIWIAQELRRIGDE
G3SU55_BCL2L11-01       ---------------------------------R-PEIWIARELRRIGDE
G3W979_BCL2L11-01       ---------------------------------R-PEIWIAQELRRIGDE
Q4KMV9_BCL2L11-01       ---------------------------------MSPELWIAQELRRIGDD
F7FTC8_BCL2L11-01       ---------------------------------R-PEIWIAQELRRIGDE
A0A2K6E226_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
M3YDI3_BCL2L11-01       ---------------------------------R-PEMWIAQELRRIGDE
F6XMC1_BCL2L11-02       ---------------------------------R-PEIWIAQELRRIGDE
F6XMC1_BCL2L11-01       ---------------------------------R-PEIWIAQELRRIGDE
F7CXT2_BCL2L11-01       ---------------------------------R-PEIWIAQELRRIGDE
O54918_BCL2L11-01       ---------------------------------R-PEIRIAQELRRIGDE
O88498_BCL2L11-01       ---------------------------------R-PEIRIAQELRRIGDE
A0A337SW42_BCL2L11      -------------------------------------GLFE---------
A0A337SW42_BCL2L11      -----------------------------------EEGVL----------
A0A2K5NU92_BCL2L11      -----------------------------------EEVVV----------
A0A2K5HZI7_BCL2L11      -----------------------------------EEVVV----------
A0A2I2YQ13_BCL2L11      -----------------------------------EEVVV----------
O43521_BCL2L11-22       -----------------------------------EEVVV----------
O43521_BCL2L11-08       -----------------------------------EEVVV----------
A0A2K5X2I7_BCL2L11      -----------------------------------EEVVV----------
F7HHA9_BCL2L11-03       -----------------------------------EEVVV----------
A0A2K6E226_BCL2L11      -----------------------------------EEVVV----------
A0A2K5Z8B6_BCL2L11      -----------------------------------EEVVV----------
A0A2I3HW02_BCL2L11      -----------------------------------EEVVV----------
A0A2R9CA99_BCL2L11      -----------------------------------EEVVV----------
A0A2J8JCT2_BCL2L11      -----------------------------------EEVVV----------
A0A2I3M6I1_BCL2L11      -----------------------------------EEVVV----------
A0A2K6KJP8_BCL2L11      -----------------------------------EEVVV----------
A0A2K6QIL2_BCL2L11      -----------------------------------EEVVV----------
A0A2K5CAB2_BCL2L11      -----------------------------------EEVVV----------
F6XMC1_BCL2L11-06       -----------------------------------EEVVV----------
A0A2K6TRZ5_BCL2L11      -----------------------------------EEVVV----------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      -----------------------------------EEVVV----------
A0A2K6GE31_BCL2L11      ------------------------------------GIFE----------
F6XMC1_BCL2L11-08       ---------------------------------KVRGIGEKQEERVNPHT
A0A2K6GE31_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2K6GE31_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A287DFJ0_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A286XJN2_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A286XJN2_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2K5CAB2_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
F6XMC1_BCL2L11-07       ---------------------------------R-PEIWIAQELRRIGDE
A0A2K6TRZ5_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
F6XMC1_BCL2L11-05       ---------------------------------R-PEIWIAQELRRIGDE
A0A2K6TRZ5_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2K5CAB2_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2K5NU92_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5HZI7_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5X2I7_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
F7HHA9_BCL2L11-02       ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6E226_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5Z8B6_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2I3M6I1_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6KJP8_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6QIL2_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2I2YQ13_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
O43521_BCL2L11-16       ---------------------------------R-PEIWIAQELRRIGDE
O43521_BCL2L11-09       ---------------------------------R-PEIWIAQELRRIGDE
A0A2R9CA99_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2J8JCT2_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2K5NU92_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5HZI7_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5X2I7_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
F7HHA9_BCL2L11-04       ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6E226_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5Z8B6_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2I3M6I1_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6KJP8_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6QIL2_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2I2YQ13_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
O43521_BCL2L11-18       ---------------------------------R-PEIWIAQELRRIGDE
A0A2I3HW02_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2R9CA99_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2J8JCT2_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2K5CAB2_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2K5CAB2_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
F6XMC1_BCL2L11-03       ---------------------------------R-PEIWIAQELRRIGDE
A0A2K6TRZ5_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2K6TRZ5_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2K6QIL2_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6QIL2_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5NU92_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5HZI7_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5X2I7_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6E226_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6E226_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5Z8B6_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2I3M6I1_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6KJP8_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6KJP8_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2I2YQ13_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
O43521_BCL2L11-03       ---------------------------------R-PEIWIAQELRRIGDE
A0A2I3HW02_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2R9CA99_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2J8JCT2_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
F1SU81_BCL2L11-02       ---------------------------------R-PEIWIAQELRRIGDE
A0A337SW42_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
Q2YDF0_BCL2L11-02       ---------------------------------R-PEIWIAQELRRIGDE
W5PY58_BCL2L11-01       ---------------------------------R-PEIWIAQELRRIGDE
G1SSY0_BCL2L11-01       ---------------------------------R-PETWIAQELRRIGDE
H0XW23_BCL2L11-01       ---------------------------------R-PEMWIAQELRRIGDE
A0A337SW42_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
G1LDR8_BCL2L11-01       ---------------------------------R-PEIWIAQELRRIGDE
J9NWV6_BCL2L11-01       ---------------------------------R-PEIWIAQELRRIGDE
F1SU81_BCL2L11-01       ---------------------------------R-PEIWIAQELRRIGDE
O43521_BCL2L11-11       ---------------------------------L-PQPPK----------
F7HHA9_BCL2L11-08       ---------------------------------L-PQPPK----------
O54918_BCL2L11-08       ---------------------------------R-PEIRIAQELRRIGDE
O54918_BCL2L11-06       ---------------------------------R-PEIRIAQELRRIGDE
O54918_BCL2L11-03       ---------------------------------H-GDAWYN---------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2I3HW02_BCL2L11      ------------------------------------EVQWPFEWLAKSS-
A0A2K6TRZ5_BCL2L11      ---------------------------------R-REVQCPLEWLAKSS-
A0A2K5HZI7_BCL2L11      ---------------------------------H-REVQ-----------
A0A2K5NU92_BCL2L11      ---------------------------------H-REVQWPLECLASS--
A0A2K5Z8B6_BCL2L11      ---------------------------------H-REVQWPLECLASS--
A0A2I2YQ13_BCL2L11      ---------------------------------H-REVQWPLEWLAKSS-
O43521_BCL2L11-23       ---------------------------------H-REVQWPLKWLAKSS-
A0A2R9CA99_BCL2L11      ---------------------------------H-REVQWPLKWLAKSS-
A0A2J8JCT2_BCL2L11      ---------------------------------H-REVQWPLKWLAKSS-
F7HHA9_BCL2L11-07       ---------------------------------H-REVQWPLEWLA----
A0A2K5CAB2_BCL2L11      ---------------------------------R-REVQWPLEWLAKSS-
A0A2K5X2I7_BCL2L11      ---------------------------------H-REVQWPLEWLASS--
A0A2I3M6I1_BCL2L11      ---------------------------------H-REVQWPLEWLASS--
C1KGB8_BCL2L11-01       ---------------------------------R-PEIWIAQELRRIGDE
A0A2K6GE31_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A337SW42_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
O43521_BCL2L11-10       ---------------------------------R-PEIWIAQELRRIGDE
O43521_BCL2L11-20       ---------------------------------R-PEIWIAQELRRIGDE
A0A2I2YQ13_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
O43521_BCL2L11-17       ---------------------------------R-PEIWIAQELRRIGDE
O43521_BCL2L11-13       ---------------------------------R-PEIWIAQELRRIGDE
A0A2I3HW02_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2R9CA99_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2J8JCT2_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2K5NU92_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5X2I7_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
F7HHA9_BCL2L11-05       ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5Z8B6_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5HZI7_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6KJP8_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6QIL2_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5CAB2_BCL2L11      ---------------------------------F-RFIFTFFDLYG----
A0A2K5Z8B6_BCL2L11      ---------------------------------F-GFIFTGLDLYG----
A0A2K6KJP8_BCL2L11      ---------------------------------F-GFIFTGLDLYVVWIY
A0A2K6QIL2_BCL2L11      ---------------------------------F-GFIFTGLDLYVVWIY
F6XMC1_BCL2L11-09       ---------------------------------F-RFTFTFFDLCG----
A0A2K6TRZ5_BCL2L11      ---------------------------------F-RFIFTFFDLYG----
A0A2K5HZI7_BCL2L11      ---------------------------------F-GFIFTGLDLYG----
A0A2R9CA99_BCL2L11      ---------------------------------F-GFIFTGLDLYG----
A0A2J8JCT2_BCL2L11      ---------------------------------F-GFIFTGLDLYG----
A0A2K5NU92_BCL2L11      ---------------------------------F-GFIFTGLDLYG----
A0A2K5X2I7_BCL2L11      ---------------------------------F-GFIFTGLDLYG----
F7HHA9_BCL2L11-09       ---------------------------------F-GFIFTGLDLYG----
A0A2K6E226_BCL2L11      ---------------------------------F-GFIFTGLDLYG----
A0A2I3M6I1_BCL2L11      ---------------------------------F-GFIFTGLDLYG----
A0A2I2YQ13_BCL2L11      ---------------------------------F-GFIFTGLDLYG----
O43521_BCL2L11-06       ---------------------------------F-GFIFTGLDLYG----
O43521_BCL2L11-15       ---------------------------------F-GFIFTGLDLYG----
A0A2I3HW02_BCL2L11      ---------------------------------F-GFIFTGLDLYG----
F1SU81_BCL2L11-03       ---------------------------------R-PEIWIAQELRRIGDE
A0A0D9RWE0_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
O43521_BCL2L11-05       ---------------------------------R-PEIWIAQELRRIGDE
O43521_BCL2L11-25       ---------------------------------R-PEIWIAQELRRIGDE
O54918_BCL2L11-05       ---------------------------------R-PEIRIAQELRRIGDE
O88498_BCL2L11-02       ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6GE31_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A286XJN2_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A337SW42_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2K5CAB2_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2K6TRZ5_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2K6QIL2_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5NU92_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5HZI7_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5X2I7_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6E226_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K5Z8B6_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2I3M6I1_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2I3M6I1_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2K6KJP8_BCL2L11      ---------------------------------R-PEIRIAQELRRIGDE
A0A2I2YQ13_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
O43521_BCL2L11-02       ---------------------------------R-PEIWIAQELRRIGDE
A0A2R9CA99_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A2J8JCT2_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
H2P5E2_BCL2L11-01       ---------------------------------R-PEIWIAQELRRIGDE
Q2YDF0_BCL2L11-01       ---------------------------------R-PEIWIAQELRRIGDE
Q2YDF0_BCL2L11-03       ---------------------------------R-PEIWIAQELRRIGDE
A0A287DFJ0_BCL2L11      ---------------------------------R-PEIWIAQELRRIGDE
A0A3B4B6Y3_BMF-01       -----------------------------------MEACIGHKLQLIGDQ
A0A3B1JLM2_BAD-01       ----------------------------------------GRQLRRMSDE
A0A3B4UNJ0_BMF-01       -----------------------------------VEAQIGRKLREIGDK
Q0GKC7_BMF-01           -----------------------------------VETLIGQKLQLIGDQ
W5N4P7_BMF-01           -----------------------------------AEVRIGQKLQRIGDQ
A0A3B3RH63_BMF-01       -----------------------------------AEVRIGQKLQMIGDQ
W5UAU7_BMF-01           -----------------------------------VEAQIGQKLQMIGDQ
A0A3B1K1X5_BMF-01       -----------------------------------VEARIGQKLQMIGDQ
A0A3B4CNJ8_BMF-01       -----------------------------------VEARIGQKLQMIGDQ
A0A2U9CJH3_BMF-01       -----------------------------------VEACIGQKLQLIGDQ
A0A3B5KWG6_BMF-01       -----------------------------------TEACIGQKLQLIGDQ
A0A3B3CGR9_BMF-01       -----------------------------------TEACIAQKLQLIGDQ
A0A3B3I0V9_BMF-04       -----------------------------------TEACIAQKLQLIGDQ
A0A3B3I0V9_BMF-01       -----------------------------------TEACIAQKLQLIGDQ
A0A3B3I0V9_BMF-02       -----------------------------------TEACIAQKLQLIGDQ
A0A3B3I0V9_BMF-03       -----------------------------------TEACIAQKLQLIGDQ
A0A3B4U5H8_BMF-01       -----------------------------------VEACIGQKLQLIGDQ
A0A3B4WM88_BMF-01       -----------------------------------VEACIGQKLQLIGDQ
I3K2D6_BMF-01           -----------------------------------VEACIGQKLQLIGDQ
A0A3B4ETH0_BMF-01       -----------------------------------VEACIGQKLQLIGDQ
A0A3B5B8F6_BMF-01       -----------------------------------VEACIGQKLQLIGDQ
A0A096LRV0_BMF-01       -----------------------------------LEACIGQKLQLIGDQ
A0A3B3WU80_BMF-01       -----------------------------------LEACIGQKLQLIGDQ
A0A3B5QK08_BMF-02       -----------------------------------LEASIGQKLQLIGDQ
A0A3B5QK08_BMF-01       -----------------------------------LEASIGQKLQLIGDQ
F6RS78_BIK-01           -----------------------------------GLRGVFRSFMDGLTN
A0A2K5JY52_PMAIP1-      -----------------------------------SQTLLLRNLTATKTC
A0A096MPU8_PMAIP1-      -----------------------------------SQTLLLRNLTASKTC
A0A2K5ZWH1_PMAIP1-      -----------------------------------SQTLLLRNLTASKTC
A0A2K5VPX2_PMAIP1-      -----------------------------------SQTLLLRNLTASKTC
A0A2K6BV75_PMAIP1-      -----------------------------------SQTLLLRNLTASKTC
A0A2K6KJF2_PMAIP1-      -----------------------------------SQTLLLRNLTASKTC
A0A2K6NC45_PMAIP1-      -----------------------------------SQTLLLRNLTASKTC
Q13794_PMAIP1-02        -----------------------------------IQTLLLRNLTASKTC
A0A2R9AKC9_PMAIP1-      -----------------------------------IQTLLLRNLTASKTC
A0A1D5QGJ8_PMAIP1-      -----------------------------------SQTLLLRNLTASKTC
A0A2I2YVQ5_PMAIP1-      -----------------------------------IQTLLLRNLTASKTC
A0A2I3SX38_PMAIP1-      -----------------------------------IQTLLLRNLTASKTC
C1C3S9_BAD-01           ----------------------------------------LRRMSDEFDQ
A0A3B4CPH6_BAD-01       -----------------------------------SDSEASSSLTAPDTR
F6Z067_BAD-01           -----------------------------------PSSMIATKYGRELRR
M3XHJ5_BCL2L11-01       -------------------------------------SLVLSTSSSGYFT
W5QCU2_BIK-01           -----------------------------------GLRDVLRSFMVAFTN
O70337_BIK-04           -----------------------------------GVRGIFRSLIRSLTN
O70337_BIK-02           -----------------------------------GVRGIFRSLIRSLTN
O70337_BIK-01           -----------------------------------GVRGIFRSLIRSLTN
Q925D2_BIK-01           -----------------------------------GVRGIFRSLIGSLTN
G1TZR9_BIK-01           -----------------------------------GFTGVLGSVGLHLAS
H0W025_BIK-01           -----------------------------------GLWGVLGRLTLSLAS
A0A2K5CLG5_BIK-01       -----------------------------------DIGDVLSGIVEVFAN
F7FUT7_BIK-01           -----------------------------------DIGDVLSGVVDVFAN
A0A2K6TBD7_BIK-01       -----------------------------------DIRDVLSGVVDVFAD
H2P4N6_BIK-01           -----------------------------------DIRDVLRSFTDGFTT
G1S1X2_BIK-01           -----------------------------------DIRDVLRSFMDGFTT
G3QCT2_BIK-01           -----------------------------------DIRDVLRSFMDGFTT
A0A2R8ZXD2_BIK-01       -----------------------------------DIRDVLRSFMDGFTT
H2QLU7_BIK-01           -----------------------------------DIRDVLRSFMDGFTT
Q13323_BIK-01           -----------------------------------DIRDVLRSFMDGFTT
A0A2K6MCW0_BIK-01       -----------------------------------DIRDVLTSFMDGFTT
A0A2K6QK74_BIK-01       -----------------------------------DIRDVLTSFMDGFTT
A0A0D9QZY8_BIK-01       -----------------------------------DIRDVLRSFIDGFTT
A0A2K5VW94_BIK-01       -----------------------------------DIRDVLRSFMDGFTT
A0A2K6DBJ4_BIK-01       -----------------------------------DIRDVLRSFMDGFTT
A0A2K5J4Q7_BIK-01       -----------------------------------DIRDVLRSFMDGFTT
A0A096NKG5_BIK-01       -----------------------------------DIRDVLRSFMDGFTT
A0A2K5LDM6_BIK-01       -----------------------------------DIRDVLRSFMDGFTT
A0A2K5XSA1_BIK-01       -----------------------------------DIRDVLRSFLDGFTT
F1PUF4_BIK-01           -----------------------------------GLRGVLRSFLDGLAN
H0XAE7_BIK-01           -----------------------------------DGQGVLRSVISGFTN
A0A2K6FM79_BIK-01       -----------------------------------VRWGVLGSLSDGFAN
F6RS78_BIK-02           ----------------------------------------RGVFRSFMDG
A0A3B1JXK6_BCL2L11      ------------------------------------HWYIAQELRRIGDE
A0A3B4BVX1_BCL2L11      ------------------------------------ESYVAQELRRIGDE
F6TGJ4_BMF-01           ------------------------------------EHRIARKLQCIGDQ
G1PAU1_BMF-01           ------------------------------------EIQIARKLQSIADQ
A2AV74_BMF-02           ------------------------------------EVQIARKLQCIADQ
A0A286XXB0_BMF-03       ------------------------------------EVQIARKLQCIADQ
I3MDS9_BMF-02           ------------------------------------EVQIARKLQCIADQ
A0A287AIU8_BMF-05       ------------------------------------EVQIARKLQCIADQ
A0A287AIU8_BMF-01       ------------------------------------EVQIARKLQCIADQ
A0A287AIU8_BMF-04       ------------------------------------EVQIARKLQCIADQ
A0A287AIU8_BMF-03       ------------------------------------EVQIARKLQCIADQ
A0A287AIU8_BMF-02       ------------------------------------EVQIARKLQCIADQ
W5UEE7_BCL2L11-01       ------------------------------------ELEIARELRRIGDE
H9GL49_BMF-01           ------------------------------------EVQIARKLQCIADQ
K7FRX2_BMF-01           ------------------------------------EVQIARKLQCIADQ
A9XRG9_BMF-02           ------------------------------------EVQIARKLQCIADQ
A9XRG9_BMF-01           ------------------------------------EVQIARKLQCIADQ
U3JS06_BMF-01           ------------------------------------EVQIARKLQCIADQ
H0ZMX5_BMF-01           ------------------------------------EVQIARKLQCIADQ
A9XRG9_BMF-03           ------------------------------------EVQIARKLQCIADQ
A9XRG9_BMF-04           ------------------------------------EVQIARKLQCIADQ
G1NHG8_BMF-01           ------------------------------------EVQIARKLQCIADQ
A0A3B4V919_BCL2L11      ------QRMAEAHGGGARMQQQH-------------------------GE
A0A3B4XZH1_BCL2L11      ------QRMAEAHGGGARMQQQQHGEHRHFASGDMQAEAVGQELRRIGDD
A0A337SQV0_BBC3-01      LTLAGRAAPGIAGAQRPGGPGGRPHPGSPGSPGGGGAVGPGDRGPAAADG
Q9BXH1_BBC3-03          LALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADG
A0A2K5KGR6_BMF-01       ------------------------------------EQERGGPQVRLGCP
A0A2K6FFR1_BMF-02       ------------------------------------EQERGRSQ------
M3WRS0_BMF-02           ------------------------------------EQEWGRSQ------
A0A2K5E1W9_BMF-02       ------------------------------------EQEWGRPE------
F7HPK0_BMF-02           ------------------------------------EQEWGRPE------
A0A2K6TW86_BMF-03       ------------------------------------KQEWGRSE------
A0A2K6RAW8_BMF-02       ------------------------------------E-------------
G3QIN5_BMF-02           ------------------------------------EQERGRP-------
Q96LC9_BMF-07           ------------------------------------EQERGRP-------
Q96LC9_BMF-05           ------------------------------------EQERGRP-------
A0A2R9BS98_BMF-02       ------------------------------------EQERGRP-------
A0A2J8QDD5_BMF-01       ------------------------------------EQERGRP-------
A0A2K5MJY6_BMF-01       ------------------------------------EQERGGP-------
G7PAW6_BMF-01           ------------------------------------EQERGGP-------
A0A2K6B5G4_BMF-03       ------------------------------------EQERGGP-------
A0A2K5Z4C3_BMF-02       ------------------------------------EQERGGP-------
A0A096NTE9_BMF-03       ------------------------------------EQERGGP-------
A0A2I3HD83_BMF-01       ------------------------------------EQEWGRP-------
A2AV74_BMF-01           ------------------------------------EVQIARKLQCIADQ
Q8K589_BMF-01           ------------------------------------EVQIARKLQCIADQ
I3MDS9_BMF-01           ------------------------------------EVQIARKLQCIADQ
G3T7Z4_BMF-01           ------------------------------------EVQIARKLQCIADH
F6X3N6_BMF-01           ------------------------------------EVQIAQKLQCIADQ
G3WDQ2_BMF-01           ------------------------------------EVQIARKLQCIADQ
Q96LC9_BMF-06           ------------------------------------E-------------
F6TJI0_BMF-02           ------------------------------------EVQIARKLQCIADQ
F6TJI0_BMF-01           ------------------------------------EVQIARKLQCIADQ
A0A286XXB0_BMF-02       ------------------------------------EVQIARKLQCIADQ
J9PB65_BMF-01           ------------------------------------EVQIARKLQCIADQ
A0A286XXB0_BMF-01       ------------------------------------EVQIARKLQCIADQ
G1SR62_BMF-01           ------------------------------------EVQIARKLQCIADQ
Q05KI3_BMF-02           ------------------------------------EIQIARKLQCIADQ
Q05KI3_BMF-01           ------------------------------------EIQIARKLQCIADQ
W5QFV1_BMF-01           ------------------------------------EIQIARKLQCIADQ
M3WRS0_BMF-01           ------------------------------------EVQIARKLQCIADQ
M3YAD5_BMF-01           ------------------------------------EVQIARKLQCIADQ
A0A2U4BC98_BMF-01       ------------------------------------EVQIARKLQRIADQ
A0A2K6FFR1_BMF-01       ------------------------------------EVQIARKLQCIADQ
H0WYH6_BMF-01           ------------------------------------EVQIARKLQCIADQ
A0A096NTE9_BMF-01       ------------------------------------EVQIARKLQCIADQ
A0A2K6L933_BMF-02       ------------------------------------EVQIARKLQCIADQ
A0A096NTE9_BMF-02       ------------------------------------EVQIARKLQCIADQ
A0A2K5MJY6_BMF-02       ------------------------------------EVQIARKLQCIADQ
A0A2K5KGR6_BMF-02       ------------------------------------EVQIARKLQCIADQ
G7PAW6_BMF-02           ------------------------------------EVQIARKLQCIADQ
F7CM09_BMF-02           ------------------------------------EVQIARKLQCIADQ
A0A2K6B5G4_BMF-04       ------------------------------------EVQIARKLQCIADQ
A0A2K6B5G4_BMF-02       ------------------------------------EVQIARKLQCIADQ
A0A2K6B5G4_BMF-01       ------------------------------------EVQIARKLQCIADQ
A0A2K5Z4C3_BMF-01       ------------------------------------EVQIARKLQCIADQ
A0A2K6L933_BMF-01       ------------------------------------EVQIARKLQCIADQ
A0A2K6L933_BMF-03       ------------------------------------EVQIARKLQCIADQ
A0A2K6RAW8_BMF-01       ------------------------------------EVQIARKLQCIADQ
A0A0D9R4R5_BMF-01       ------------------------------------EVQIARKLQCIADQ
F7HPK0_BMF-01           ------------------------------------EVQIARKLQCIADQ
A0A2K5E1W9_BMF-01       ------------------------------------EVQIARKLQCIADQ
A0A2K6TW86_BMF-02       ------------------------------------EVQIARKLQCIADQ
A0A2K6TW86_BMF-01       ------------------------------------EVQIARKLQCIADQ
G3QIN5_BMF-01           ------------------------------------EVQIARKLQCIADQ
Q96LC9_BMF-02           ------------------------------------EVQIARKLQCIADQ
Q96LC9_BMF-01           ------------------------------------EVQIARKLQCIADQ
Q96LC9_BMF-04           ------------------------------------EVQIARKLQCIADQ
Q96LC9_BMF-03           ------------------------------------EVQIARKLQCIADQ
A0A2R9BS98_BMF-01       ------------------------------------EVQIARKLQCIADQ
A0A2J8QDD5_BMF-02       ------------------------------------EVQIARKLQCIADQ
A0A2J8T301_BMF-01       ------------------------------------EVQIARKLQCIADQ
A0A3B3VNE0_BCL2L11      ------QRMAVEHGGLGLHGHSPNHYSTINAARDMQSETFGRQLRAIGDD
A0A3B3YII5_BCL2L11      ------QRMAVEHGGLGLHGHSPNHYSTINAARDMQSENFGRQLRAIGDD
A0A3B3YII5_BCL2L11      ------QRMAVEHGGLGLHGHSPNHYSTINAARDMQSENFGRQLRAIGDD
A0A3B5M375_BCL2L11      ------QRMAVEHGGLGLQGEQT---SVLPPPPSETSTTWEQ--------
A0A3B5QAM1_BCL2L11      ------QRMAVEHGGLGLHGQSPNHYSTINAARDMQSETYGRQLRAIGDE
A0A3B5QAM1_BCL2L11      ------QRMAVEHGGLGLHGQSPNHYSTINAARDMQSETYGRQLRAIGDE
E7FBJ6_BAD-01           ----------------------------------------GRQLRRMSDE
B5XEF1_BAD-01           ----------------------------------------GCQLRRMSDE
Q9GL49_PMAIP1-01        ----------------------------------------GRRSRRNTQT
A0A3B4BVX1_BCL2L11      ------------------------------------ESYVAQELRRIGDE
A0A3B4BVX1_BCL2L11      ------------------------------------ESYVAQELRRIGDE
I3K7B6_BAD-01           ----------------------------------------GQKLRRMSDE
A0A3B4GXJ6_BAD-01       ----------------------------------------GRQLRRMSDE
B5X1T1_BAD-01           ----------------------------------------GRQLRRMSDE
H3ANP3_BAD-03           ----------------------------------------GQELRRMSDE
H3ANP3_BAD-01           ----------------------------------------GQELRRMSDE
H3ANP3_BAD-02           ----------------------------------------GQELRRMSDE
H3ANP3_BAD-04           ----------------------------------------GQELRRMSDE
H3D8J8_BAD-01           ----------------------------------------GRQLRRMSDE
A0A3B5L9R9_BAD-01       ----------------------------------------GRQLRRMSDE
A0A3B1IH05_BAD-01       ----------------------------------------GRQLRKMSDE
Q4V925_BAD-02           ----------------------------------------GQQLRRMSDE
Q4V925_BAD-03           ----------------------------------------GQQLRRMSDE
A7MCM4_BAD-01           ----------------------------------------GQQLRRMSDE
Q4V925_BAD-04           ----------------------------------------GQQLRRMSDE
Q4V925_BAD-01           ----------------------------------------GQQLRRMSDE
A0A3B3BQF7_BAD-01       ----------------------------------------GQQLRRMSDE
A0A2U9BAC9_BAD-01       ----------------------------------------GQKLRRMSDE
A0A3B4VFC5_BAD-01       ----------------------------------------GQKLRRMSDE
A0A3B4W9T1_BAD-01       ----------------------------------------GQKLRRMSDE
A0A3B3QX41_BAD-01       ----------------------------------------GRQLRRMSDE
A0A1W4YVX7_BAD-01       ----------------------------------------GRQLRRMSDE
A0A1W4YVX7_BAD-02       ----------------------------------------GRQLRRMSDE
A0A3B5K831_BAD-01       ----------------------------------------GRQLRRMSDE
A0A087X8P8_BAD-01       ----------------------------------------GRQLRRMSDE
A0A3B3UA11_BAD-01       ----------------------------------------GRQLRRMSDE
A0A3B3YFR1_BAD-01       ----------------------------------------GRQLRRMSDE
A0A3B5Q2N7_BAD-01       ----------------------------------------GRQLRRMSDE
A0A3B3HDU2_BAD-01       ----------------------------------------GQQLRRMSDE
G3Q8B3_BAD-01           ----------------------------------------GRQLRRMSDE
A0A3B5BAL2_BAD-01       ----------------------------------------GQKLRRMSDE
A0A2D0SYM2_BAD-01       ----------------------------------------GRQLRRMSDE
A0A3B4DUY7_BAD-01       ----------------------------------------GRQLRRMSDE
A0A2I3HWI8_BBC3-03      ----------------------------------------GAQLRRMADD
A0A2K6FQZ3_BBC3-04      ----------------------------------------GAQLRRMADD
Q9BXH1_BBC3-05          ----------------------------------------GAQLRRMADD
A0A2R9BZA9_BBC3-01      ----------------------------------------GAQLRRMADD
A0A2I3RGH5_BBC3-03      ----------------------------------------GAQLRRMADD
A0A2K5P2T8_BBC3-03      ----------------------------------------GAQLRRMADD
A0A2K5V8J3_BBC3-03      ----------------------------------------GAQLRRMADD
F7FFP6_BBC3-03          ----------------------------------------GAQLRRMADD
A0A2K6ASP2_BBC3-03      ----------------------------------------GAQLRRMADD
A0A2I3N2Z9_BBC3-03      ----------------------------------------GAQLRRMADD
A0A2K6QZU4_BBC3-04      ----------------------------------------GAQLRRMADD
A0A2R8MW85_BBC3-03      ----------------------------------------GAQLRRMADD
A0A2K6STD6_BBC3-02      ----------------------------------------GAQLRRMADD
G3T2N1_BBC3-01          ----------------------------------------GAQFRRKADD
M3Y0R3_BBC3-01          ----------------------------------------GAQLRRMADD
Q99ML1_BBC3-02          ----------------------------------------GAQLRRMADD
Q80ZG6_BBC3-01          ----------------------------------------GAQLRRMADD
H0XQ00_BBC3-01          ----------------------------------------GAQLRRMADD
J9NTK9_BBC3-01          ----------------------------------------GAQLRRMADD
A0A337SQV0_BBC3-02      ----------------------------------------GAQLRRMADD
F1RM01_BBC3-01          ----------------------------------------GAQLRRMADD
A0A2K6FQZ3_BBC3-01      ----------------------------------------GAQLRRMADD
Q9BXH1_BBC3-06          ----------------------------------------GAQLRRMADD
A0A2I3RIG5_BBC3-02      ----------------------------------------GAQLRRMADD
H2NZD3_BBC3-01          ----------------------------------------GAQLRRMADD
A0A2K6QZU4_BBC3-01      ----------------------------------------GAQLRRMADD
A0A0D9S2H2_BBC3-01      ----------------------------------------GAQLRRMADD
B4DQK3_BBC3-01          ----------------------------------------GAQLRRMADD
G1SS60_BAD-01           ----------------------------------------GRELRRMSDE
K7E5Y2_BBC3-02          ----------------------------------------GAQLRRMADD
A0A337SAW2_BAD-01       ----------------------------------------GRELRRMSDE
A0A2I3TBK7_BAD-01       ------------------------------------------KLRPLPVT
A0A2R8Z697_BAD-02       ------------------------------------------KLRPLPVT
A0A2I2Z8C7_BAD-03       ------------------------------------------KLRPLPVT
Q92934_BAD-03           ------------------------------------------KLRPLPVT
A0A2K5M0C1_BAD-02       ------------------------------------------KLRPLPVT
A0A2K5XJR2_BAD-02       ------------------------------------------KLRPLPVT
A0A2I3MCN5_BAD-03       ------------------------------------------KLRPLPVT
A0A2K5VCD8_BAD-02       ------------------------------------------KLRTLPVT
F7GVS7_BAD-02           ------------------------------------------KLRTLPVT
A0A2K6E7J3_BAD-02       ------------------------------------------KLRTLPVT
A0A2K5E6K7_BAD-02       ------------------------------------------RLRSLPVT
A0A2K6TG62_BAD-02       ------------------------------------------RLRSLPVT
A0A2K5E6K7_BAD-03       ----------------------------------------NVKLE-VPC-
A0A2K5HKW9_BAD-02       ----------------------------------------NVKLEALGL-
A0A2K6N1A1_BAD-02       ----------------------------------------NVKLEALGL-
A0A2K6PUM5_BAD-02       ----------------------------------------NVKLEALGL-
A0A2K5M0C1_BAD-03       ----------------------------------------NVKLKALGL-
A0A2K5VCD8_BAD-03       ----------------------------------------NVKLKALGL-
F7GVS7_BAD-03           ----------------------------------------NVKLKALGL-
A0A2K5XJR2_BAD-03       ----------------------------------------NVKLKALGL-
A0A2I3MCN5_BAD-02       ----------------------------------------NVKLKALGL-
A0A2K6E7J3_BAD-03       ----------------------------------------NVKLKALGL-
A0A2I2Z8C7_BAD-04       ----------------------------------------NVKLEALGL-
Q92934_BAD-04           ----------------------------------------NVKLEALGL-
A0A2I3TBK7_BAD-03       ----------------------------------------NVKLEALGL-
A0A2R8Z697_BAD-03       ----------------------------------------NVKLEALGL-
F6SJL0_BAD-02           ----------------------------------------NVKLEALGL-
A0A2K6TG62_BAD-03       ----------------------------------------NVKLEALEP-
G1P8C5_BAD-01           ----------------------------------------GRELRRMSDE
W5P8G9_BAD-01           ----------------------------------------GRELRRMSDE
G3VRY4_BAD-02           ----------------------------------------GSELRRMSDE
G3VRY4_BAD-01           ----------------------------------------GSELRRMSDE
I3MBM5_BAD-02           ----------------------------------------GRELRRMSDE
I3MBM5_BAD-01           ----------------------------------------GRELRRMSDE
Q61337_BAD-03           ----------------------------------------GRELRRMSDE
Q61337_BAD-01           ----------------------------------------GRELRRMSDE
Q61337_BAD-02           ----------------------------------------GRELRRMSDE
G3TP47_BAD-01           ----------------------------------------GRELRRMSDE
F7DN67_BAD-01           ----------------------------------------GRELRRMSDE
G1MI17_BAD-01           ----------------------------------------GRELRRMSDE
A0A287AEF3_BAD-01       ----------------------------------------GRELRRMSDE
O35147_BAD-01           ----------------------------------------GRELRRMSDE
M3YNE7_BAD-01           ----------------------------------------GRELRRMSDE
F1MUT9_BAD-01           ----------------------------------------GRELRRMSDE
Q3SYZ0_BAD-01           ----------------------------------------GRELRRMSDE
H0WVR2_BAD-01           ----------------------------------------GRELRRMSDE
H0V608_BAD-01           ----------------------------------------GRELRRMSDE
A0A2K5E6K7_BAD-01       ----------------------------------------GRELRRMSDE
A0A2K6TG62_BAD-01       ----------------------------------------GRELRRMSDE
A0A0D9R491_BAD-01       ----------------------------------------GRELRRMSDE
A0A2K5M0C1_BAD-01       ----------------------------------------GRELRRMSDE
A0A2K5VCD8_BAD-01       ----------------------------------------GRELRRMSDE
F7GVS7_BAD-01           ----------------------------------------GRELRRMSDE
A0A2K6E7J3_BAD-01       ----------------------------------------GRELRRMSDE
A0A2K5XJR2_BAD-01       ----------------------------------------GRELRRMSDE
A0A2I3MCN5_BAD-04       ----------------------------------------GRELRRMSDE
A0A2K6N1A1_BAD-01       ----------------------------------------GRELRRMSDE
A0A2K6PUM5_BAD-01       ----------------------------------------GRELRRMSDE
A0A2K5HKW9_BAD-01       ----------------------------------------GRELRRMSDE
B4DZQ9_BAD-01           ----------------------------------------GRELRRMSDE
A0A2K6GWV0_BAD-01       ----------------------------------------GRELRRMSDE
F6SJL0_BAD-01           ----------------------------------------GRELRRMSDE
A0A2I3MCN5_BAD-01       ----------------------------------------GRELRRMSDE
A0A2I2Z8C7_BAD-02       ----------------------------------------GRELRRMSDE
A0A2I2Z8C7_BAD-01       ----------------------------------------GRELRRMSDE
Q92934_BAD-01           ----------------------------------------GRELRRMSDE
Q92934_BAD-02           ----------------------------------------GRELRRMSDE
A0A2I3TBK7_BAD-02       ----------------------------------------GRELRRMSDE
A0A2R8Z697_BAD-01       ----------------------------------------GRELRRMSDE
A0A2J8TYJ3_BAD-01       ----------------------------------------GRELRRMSDE
F1PK10_BAD-01           ----------------------------------------GRELRRMSDE
Q45KI9_BAD-01           ----------------------------------------GRELRRMSDE
                                                                          

A0A0P0HZF9_PMAIP1-      F-------------------------------------------------
Q0GKC8_PMAIP1-01        L-------------------------------------------------
A0A3B5RFA9_PMAIP1-      L-------------------------------------------------
U3IW89_BCL2L11-01       M-------------------------------------------------
Q6JTU4_BCL2L11-01       F-------------------------------------------------
A0A2I3HX97_PMAIP1-      L-------------------------------------------------
A0A1D5PAR2_PMAIP1-      A-------------------------------------------------
A0A2K6EM90_PMAIP1-      L-------------------------------------------------
G1P8F9_PMAIP1-01        L-------------------------------------------------
G3T0P7_PMAIP1-01        I-------------------------------------------------
Q1PCT2_PMAIP1-01        L-------------------------------------------------
G1LIZ7_PMAIP1-01        L-------------------------------------------------
A0A2K5NJZ2_PMAIP1-      L-------------------------------------------------
A0A0D9S003_PMAIP1-      L-------------------------------------------------
A0A2K5VPX2_PMAIP1-      L-------------------------------------------------
A0A2K6BV75_PMAIP1-      L-------------------------------------------------
A0A2K5ZWH1_PMAIP1-      L-------------------------------------------------
A0A096MPU8_PMAIP1-      L-------------------------------------------------
A0A2K5JY52_PMAIP1-      L-------------------------------------------------
A0A2K6KJF2_PMAIP1-      L-------------------------------------------------
A0A2K6NC45_PMAIP1-      L-------------------------------------------------
A0A2K6S6C4_PMAIP1-      L-------------------------------------------------
A0A2I2YVQ5_PMAIP1-      L-------------------------------------------------
Q13794_PMAIP1-01        L-------------------------------------------------
A0A2R9AKC9_PMAIP1-      L-------------------------------------------------
A0A2I3SX38_PMAIP1-      L-------------------------------------------------
H2NWG2_PMAIP1-01        L-------------------------------------------------
A0A2K5CFK7_PMAIP1-      L-------------------------------------------------
F7GW45_PMAIP1-01        L-------------------------------------------------
A0A337SUX1_PMAIP1-      L-------------------------------------------------
W5P738_PMAIP1-01        L-------------------------------------------------
A0A287AZR7_PMAIP1-      L-------------------------------------------------
G1MV54_BCL2L11-01       FNASY-CPRRGFLDNH----------------------------------
G1PDJ5_BCL2L11-01       FNNSYRNPRRDFLNVYR---------------------------------
K7E5Y2_BBC3-01          LNALYEQRRRE---------------------------------------
A9XRH0_BMF-01           ---QVWWQLFLFLHNLALNVEANRNRTGQR--------------------
R4G9R5_BCL2L11-01       IILRLLHYIVRFIWRMQ---------------------------------
A3KND0_BMF-01           FNASIPHESHRFHRLFQV--------------------------------
Q6P7C5_BAD-01           FLSHVP--------------------------------------------
A0A287AEF3_BAD-02       MRSSAPSAADRSRRPPSSGLHSVMAASSGG--------------------
I3LVX0_BIK-01           LASLRENMWFWRPAAPSTRVPP----------------------------
O61667_EGL1-01          FDAQMMSY------------------------------------------
A0A286XF37_PMAIP1-      L-------------------------------------------------
A0A2K5F6X4_BBC3-02      LNAQYERRRQE---------------------------------------
A0A337SQV0_BBC3-03      LNALYERRRQE---------------------------------------
Q9JM54_PMAIP1-01        V-------------------------------------------------
Q5U777_PMAIP1-01        V-------------------------------------------------
F1SMU1_PMAIP1-01        LN------------------------------------------------
Q9BXH1_BBC3-04          LCTM----------------------------------------------
B2KKY9_BCL2L11-01       FNRLYCEAGAGVNQLRA---------------------------------
B8JK68_BCL2L11-01       FNRLYCEAGAGVNQLHA---------------------------------
A0A3B3QC78_BCL2L11      FNDIYINGVSILLCPHC---------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
F7G1G0_HRK-01           ----WLLRRRNL--------------------------------------
P62816_HRK-03           ----WLLGRRSA--------------------------------------
P62817_HRK-01           ----WLLGRRSA--------------------------------------
A0A287A5N9_HRK-01       ----WLLGRRNL--------------------------------------
H2NIS8_HRK-01           ----WLLGRRNL--------------------------------------
A0A2K5KZ69_HRK-01       ----WLLSRRNL--------------------------------------
H2Q6Y8_HRK-01           ----WLLGRRNL--------------------------------------
G3UH24_HRK-01           ----WLLRRRNL--------------------------------------
A0A2K5BYA0_HRK-01       ----WLLGRRNL--------------------------------------
U3E722_HRK-01           ----WLLGRRNL--------------------------------------
A0A0D9SC73_HRK-01       ----WLLGRRNL--------------------------------------
A0A337SQ56_HRK-01       ----WLLGRRNL--------------------------------------
G3QTJ6_HRK-01           ----WLLGRRNL--------------------------------------
O00198_HRK-01           ----WLLGRRNL--------------------------------------
A0A1D5R1E4_HRK-01       ----WLLGRRNL--------------------------------------
A0A2K6AYL7_HRK-01       ----WLLGRRNL--------------------------------------
G1QHD8_HRK-01           ----WLLGRRNL--------------------------------------
G1T7W1_HRK-01           ----WLLGRRNL--------------------------------------
H0Y001_HRK-01           ----WLLGRRNL--------------------------------------
A0A096N944_HRK-01       ----WLLGRRNL--------------------------------------
A0A2K6GL98_HRK-01       ----WLLGRRNL--------------------------------------
E2RLD4_HRK-01           ----WLLGRRNL--------------------------------------
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       FNASYCPRRGFL--------------------------------------
G3SU55_BCL2L11-01       FNA-YYPRRAFL-NNYQ---------------------------------
G3W979_BCL2L11-01       FNA-SYPRRGFLDNNYQ---------------------------------
Q4KMV9_BCL2L11-01       FNASFSPRRGIF-NNLP---------------------------------
F7FTC8_BCL2L11-01       FNASYCPRRGLL-DNNN---------------------------------
A0A2K6E226_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
M3YDI3_BCL2L11-01       FNA-YYPRRVFL-NNYP---------------------------------
F6XMC1_BCL2L11-02       FNA-YYPRRVNW-ILPF---------------------------------
F6XMC1_BCL2L11-01       FNA-YYPRRVNW-ILPF---------------------------------
F7CXT2_BCL2L11-01       FNASYYPRRGFL-DNNY---------------------------------
O54918_BCL2L11-01       FNE-TYTRRVFA-NDYR---------------------------------
O88498_BCL2L11-01       FNE-TYTRRAFA-NDYR---------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       WET-FKSTRTHS-LSAR---------------------------------
A0A2K6GE31_BCL2L11      FNA-YYPRRMPL-PSD----------------------------------
A0A2K6GE31_BCL2L11      FNA-YYPRRVFL-NNYQ---------------------------------
A0A287DFJ0_BCL2L11      FNL-YYPRRVFF-NNYQ---------------------------------
A0A286XJN2_BCL2L11      FNA-SYPRRVFL-NHYQ---------------------------------
A0A286XJN2_BCL2L11      FNA-SYPRRVFL-NHYQ---------------------------------
A0A2K5CAB2_BCL2L11      FNA-YYPRRLEK--------------------------------------
F6XMC1_BCL2L11-07       FNA-YYPRRLEK--------------------------------------
A0A2K6TRZ5_BCL2L11      FNA-YYPRRLEK--------------------------------------
F6XMC1_BCL2L11-05       FNA-YYPRRISL-LPD----------------------------------
A0A2K6TRZ5_BCL2L11      FNA-YYPRRISL-PPD----------------------------------
A0A2K5CAB2_BCL2L11      FNA-YYPRRISL-PSD----------------------------------
A0A2K5NU92_BCL2L11      FNA-YYARRMSL-PPD----------------------------------
A0A2K5HZI7_BCL2L11      FNA-YYARRMSL-PPD----------------------------------
A0A2K5X2I7_BCL2L11      FNA-YYARRMSL-PPD----------------------------------
F7HHA9_BCL2L11-02       FNA-YYARRMSL-PPD----------------------------------
A0A2K6E226_BCL2L11      FNA-YYARRMSL-PPD----------------------------------
A0A2K5Z8B6_BCL2L11      FNA-YYARRMSL-PPD----------------------------------
A0A2I3M6I1_BCL2L11      FNA-YYARRMSL-PPD----------------------------------
A0A2K6KJP8_BCL2L11      FNA-YYARRMSL-PPD----------------------------------
A0A2K6QIL2_BCL2L11      FNA-YYARRMSL-PPD----------------------------------
A0A2I2YQ13_BCL2L11      FNA-YYARRMPL-PPD----------------------------------
O43521_BCL2L11-16       FNA-YYARRMPL-PPD----------------------------------
O43521_BCL2L11-09       FNA-YYARRMPL-PPD----------------------------------
A0A2R9CA99_BCL2L11      FNA-YYARRMPL-PPD----------------------------------
A0A2J8JCT2_BCL2L11      FNA-YYARRMPL-PPD----------------------------------
A0A2K5NU92_BCL2L11      FNA-YYARRLEK--------------------------------------
A0A2K5HZI7_BCL2L11      FNA-YYARRLEK--------------------------------------
A0A2K5X2I7_BCL2L11      FNA-YYARRLEK--------------------------------------
F7HHA9_BCL2L11-04       FNA-YYARRLEK--------------------------------------
A0A2K6E226_BCL2L11      FNA-YYARRLEK--------------------------------------
A0A2K5Z8B6_BCL2L11      FNA-YYARRLEK--------------------------------------
A0A2I3M6I1_BCL2L11      FNA-YYARRLEK--------------------------------------
A0A2K6KJP8_BCL2L11      FNA-YYARRLEK--------------------------------------
A0A2K6QIL2_BCL2L11      FNA-YYARRLEK--------------------------------------
A0A2I2YQ13_BCL2L11      FNA-YYARRLEK--------------------------------------
O43521_BCL2L11-18       FNA-YYARRLEK--------------------------------------
A0A2I3HW02_BCL2L11      FNA-YYARRLEK--------------------------------------
A0A2R9CA99_BCL2L11      FNA-YYARRLEK--------------------------------------
A0A2J8JCT2_BCL2L11      FNA-YYARRLEK--------------------------------------
A0A2K5CAB2_BCL2L11      FNA-YYPRRVFL-NNYQ---------------------------------
A0A2K5CAB2_BCL2L11      FNA-YYPRRVFL-NNYQ---------------------------------
F6XMC1_BCL2L11-03       FNA-YYPRRVFL-NNYQ---------------------------------
A0A2K6TRZ5_BCL2L11      FNA-YYPRRVFL-NNYQ---------------------------------
A0A2K6TRZ5_BCL2L11      FNA-YYPRRVFL-NNYQ---------------------------------
A0A2K6QIL2_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K6QIL2_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K5NU92_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K5HZI7_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K5X2I7_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K6E226_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K6E226_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K5Z8B6_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2I3M6I1_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K6KJP8_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K6KJP8_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2I2YQ13_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
O43521_BCL2L11-03       FNA-YYARRVFL-NNYQ---------------------------------
A0A2I3HW02_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2R9CA99_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2J8JCT2_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
F1SU81_BCL2L11-02       FNA-YYPRRVML-FSLP---------------------------------
A0A337SW42_BCL2L11      FNA-YYPRRLEQ--------------------------------------
Q2YDF0_BCL2L11-02       FNA-YYPRRVFV-R-HQ---------------------------------
W5PY58_BCL2L11-01       FNA-YYPRRVFV-R-HQ---------------------------------
G1SSY0_BCL2L11-01       FNA-YYPRRVFL-NNYP---------------------------------
H0XW23_BCL2L11-01       FNA-YYPTRVFL-HNYQ---------------------------------
A0A337SW42_BCL2L11      FNA-YYPRRVFL-NNYQ---------------------------------
G1LDR8_BCL2L11-01       FNA-YYPRRVFL-NNYQ---------------------------------
J9NWV6_BCL2L11-01       FNA-YYPRRVFL-NNYQ---------------------------------
F1SU81_BCL2L11-01       FNA-YYPRRVFL-NNYQ---------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-08       FNE-TYTRRVFA-NDYR---------------------------------
O54918_BCL2L11-06       FNE-TYTRRVFA-NDYR---------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       FNA-YYPRRVML-FSLP---------------------------------
A0A2K6GE31_BCL2L11      FNA-YYPRRLAK-CLVP---------------------------------
A0A337SW42_BCL2L11      FNA-YYPRRLAR-VPAS---------------------------------
O43521_BCL2L11-10       FNA-YYARRMPL-PPD----------------------------------
O43521_BCL2L11-20       FNA-YYARRMPL-PPD----------------------------------
A0A2I2YQ13_BCL2L11      FNA-YYARRLAK-LLAS---------------------------------
O43521_BCL2L11-17       FNA-YYARRLAK-LLAS---------------------------------
O43521_BCL2L11-13       FNA-YYARRLAK-LLAS---------------------------------
A0A2I3HW02_BCL2L11      FNA-YYARRLAK-LLAS---------------------------------
A0A2R9CA99_BCL2L11      FNA-YYARRLAK-LLSS---------------------------------
A0A2J8JCT2_BCL2L11      FNA-YYARRLAK-LLAS---------------------------------
A0A2K5NU92_BCL2L11      FNA-YYARRLAE-LLAS---------------------------------
A0A2K5X2I7_BCL2L11      FNA-YYARRLAE-LLAS---------------------------------
F7HHA9_BCL2L11-05       FNA-YYARRLAE-LLAS---------------------------------
A0A2K5Z8B6_BCL2L11      FNA-YYARRLAE-LLAS---------------------------------
A0A2K5HZI7_BCL2L11      FNA-YYARRLAK-LLAS---------------------------------
A0A2K6KJP8_BCL2L11      FNA-YYARRLAK-LLAS---------------------------------
A0A2K6QIL2_BCL2L11      FNA-YYARRLAK-LLAS---------------------------------
A0A2K5CAB2_BCL2L11      -HH-HSQGTEQL-HHKY---------------------------------
A0A2K5Z8B6_BCL2L11      -HH-HSQDTEQL-NHKD---------------------------------
A0A2K6KJP8_BCL2L11      IYH-HSQDTEQL-NHRD---------------------------------
A0A2K6QIL2_BCL2L11      IYH-HSQDTEQL-NHRD---------------------------------
F6XMC1_BCL2L11-09       -HH-HSQGTEQQ-HKDF---------------------------------
A0A2K6TRZ5_BCL2L11      -YH-HSQGTEQL-HHKY---------------------------------
A0A2K5HZI7_BCL2L11      -HH-HSQDTEQL-NHRD---------------------------------
A0A2R9CA99_BCL2L11      -HH-HSQDAEQL-NHKD---------------------------------
A0A2J8JCT2_BCL2L11      -HH-HSQDAEQL-NHKD---------------------------------
A0A2K5NU92_BCL2L11      -HH-HSQDTEQL-NHKD---------------------------------
A0A2K5X2I7_BCL2L11      -HH-HSQDTEQL-NHKD---------------------------------
F7HHA9_BCL2L11-09       -HH-HSQDTEQL-NHKD---------------------------------
A0A2K6E226_BCL2L11      -HH-HSQDTEQL-NHKD---------------------------------
A0A2I3M6I1_BCL2L11      -HH-HSQDTEQL-NHKD---------------------------------
A0A2I2YQ13_BCL2L11      -HH-HSQDTEQL-NHKD---------------------------------
O43521_BCL2L11-06       -HH-HSQDTEQL-NHKD---------------------------------
O43521_BCL2L11-15       -HH-HSQDTEQL-NHKD---------------------------------
A0A2I3HW02_BCL2L11      -HH-HSQDTEQF-NHKD---------------------------------
F1SU81_BCL2L11-03       FNA-YYPRRVML-FSLP---------------------------------
A0A0D9RWE0_BCL2L11      FNA-YYARRLEK--------------------------------------
O43521_BCL2L11-05       FNA-YYARRLEK--------------------------------------
O43521_BCL2L11-25       FNA-YYARRLEK--------------------------------------
O54918_BCL2L11-05       FNE-TYTRRVFA-NDYR---------------------------------
O88498_BCL2L11-02       FNE-TYTRRAFA-NDYR---------------------------------
A0A2K6GE31_BCL2L11      FNA-YYPRRVFL-NNYQ---------------------------------
A0A286XJN2_BCL2L11      FNA-SYPRRVFL-NHYQ---------------------------------
A0A337SW42_BCL2L11      FNA-YYPRRVFL-NNYQ---------------------------------
A0A2K5CAB2_BCL2L11      FNA-YYPRRVFL-NNYQ---------------------------------
A0A2K6TRZ5_BCL2L11      FNA-YYPRRVFL-NNYQ---------------------------------
A0A2K6QIL2_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K5NU92_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K5HZI7_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K5X2I7_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K6E226_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K5Z8B6_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2I3M6I1_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2I3M6I1_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2K6KJP8_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2I2YQ13_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
O43521_BCL2L11-02       FNA-YYARRVFL-NNYQ---------------------------------
A0A2R9CA99_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
A0A2J8JCT2_BCL2L11      FNA-YYARRVFL-NNYQ---------------------------------
H2P5E2_BCL2L11-01       FNA-YYARRVFL-NNYQ---------------------------------
Q2YDF0_BCL2L11-01       FNA-YYPRRVFV-RH-Q---------------------------------
Q2YDF0_BCL2L11-03       FNA-YYPRRVFV-RH-Q---------------------------------
A0A287DFJ0_BCL2L11      FNL-YYPRRVFF-NN-Y---------------------------------
A0A3B4B6Y3_BMF-01       FHRDHLQRVREH--------------------------------------
A0A3B1JLM2_BAD-01       FDTWLDKGDLRRTTG-----------------------------------
A0A3B4UNJ0_BMF-01       FQQDHFMR------------------------------------------
Q0GKC7_BMF-01           FYQEHI---MH---------------------------------------
W5N4P7_BMF-01           FHRDYLHMYRR---------------------------------------
A0A3B3RH63_BMF-01       FHQDQLQLYHR---------------------------------------
W5UAU7_BMF-01           FYQEHM-LQHQ---------------------------------------
A0A3B1K1X5_BMF-01       FYQEHM-LQHR---------------------------------------
A0A3B4CNJ8_BMF-01       FYQEHM-LQHR---------------------------------------
A0A2U9CJH3_BMF-01       FHREHLQLYHR---------------------------------------
A0A3B5KWG6_BMF-01       FHRERVQLYQR---------------------------------------
A0A3B3CGR9_BMF-01       FHRERLQLYHQ---------------------------------------
A0A3B3I0V9_BMF-04       FHRERLQLYHR---------------------------------------
A0A3B3I0V9_BMF-01       FHRERLQLYHR---------------------------------------
A0A3B3I0V9_BMF-02       FHRERLQLYHR---------------------------------------
A0A3B3I0V9_BMF-03       FHRERLQLYHR---------------------------------------
A0A3B4U5H8_BMF-01       FHREHLQLYHQ---------------------------------------
A0A3B4WM88_BMF-01       FHREHLQLYHQ---------------------------------------
I3K2D6_BMF-01           FHWERLQLYHR---------------------------------------
A0A3B4ETH0_BMF-01       FHWERLQLYHR---------------------------------------
A0A3B5B8F6_BMF-01       FHREHLQLYHR---------------------------------------
A0A096LRV0_BMF-01       FHREHLQQYQQ---------------------------------------
A0A3B3WU80_BMF-01       FHREHLQQYQQ---------------------------------------
A0A3B5QK08_BMF-02       FHREHLQQYQQ---------------------------------------
A0A3B5QK08_BMF-01       FHREHLQQYQQ---------------------------------------
F6RS78_BIK-01           LRENI-RFWSF--LTRRDRVSLRFHDLDSPSCMCSPLEPWSSCPVGHSLA
A0A2K5JY52_PMAIP1-      MRGLQKRIF----LRRCTFHQFE---------------------------
A0A096MPU8_PMAIP1-      IGGLQKRLF----LRRCTLHQFE---------------------------
A0A2K5ZWH1_PMAIP1-      IRGLQKRLF----LRRCILHKFE---------------------------
A0A2K5VPX2_PMAIP1-      IRGLQKRLF----LRRCTLHQFE---------------------------
A0A2K6BV75_PMAIP1-      IRGLQKRLF----LRRCTLHQFE---------------------------
A0A2K6KJF2_PMAIP1-      IRGLQTRIF----LRRCTFHQFE---------------------------
A0A2K6NC45_PMAIP1-      IRGLQTRIF----LRRCTFHQFE---------------------------
Q13794_PMAIP1-02        MRGLLQKSF----LRRCTFHQFE---------------------------
A0A2R9AKC9_PMAIP1-      MRGLLQKSF----LRRCTFHQFE---------------------------
A0A1D5QGJ8_PMAIP1-      IRGLQKRLF----LRRCTLHQFE---------------------------
A0A2I2YVQ5_PMAIP1-      MRGLLQKSF----LRRCTFHQFE---------------------------
A0A2I3SX38_PMAIP1-      MRGLLQKSF----LRRCTFHQFE---------------------------
C1C3S9_BAD-01           IFTSI--------PRPKSASAAT---------------------------
A0A3B4CPH6_BAD-01       PAE-----------------------------------------------
F6Z067_BAD-01           MSDEFEKSFTG--LPRPKSASAA---------------------------
M3XHJ5_BCL2L11-01       FDSDIVHS-----PAPVSVHKAT---------------------------
W5QCU2_BIK-01           LRENR-RLWSF--LTLRDRVSPS---------------------------
O70337_BIK-04           LRENIWS-WRV--LTPGAWVSPD---------------------------
O70337_BIK-02           LRENIWS-WRV--LTPGAWVSPD---------------------------
O70337_BIK-01           LRENIWS-WRV--LTPGAWVSPD---------------------------
Q925D2_BIK-01           LRENIWS-WRV--FTPGAWVSPD---------------------------
G1TZR9_BIK-01           LVE----LWSPWGRGAAAPAAVR---------------------------
H0W025_BIK-01           LRDNV---WACGRPASRAWVSPR---------------------------
A0A2K5CLG5_BIK-01       FQEDIVRLWRS--LSSGSWVSRK---------------------------
F7FUT7_BIK-01           FQEDIVRLWRS--LSSGSWVSRK---------------------------
A0A2K6TBD7_BIK-01       FQEDIVRLWRS--LSSGSWVSGK---------------------------
H2P4N6_BIK-01           LKENIMRFWSS--L------------------------------------
G1S1X2_BIK-01           FKENIIRLWRS--PNPGSRVSRE---------------------------
G3QCT2_BIK-01           LKENIMRFWRS--PNPGSWVSRE---------------------------
A0A2R8ZXD2_BIK-01       LKENIMRFWRS--PNPRSWVSRE---------------------------
H2QLU7_BIK-01           LKENIMRFWRS--PNPGSWVSRE---------------------------
Q13323_BIK-01           LKENIMRFWRS--PNPGSWVSCE---------------------------
A0A2K6MCW0_BIK-01       LKENIMRFWRS--LNPGSQVSRE---------------------------
A0A2K6QK74_BIK-01       LKENIMRFWRS--LNPGSQVSRE---------------------------
A0A0D9QZY8_BIK-01       LRENIMRFWRS--LNPGSWVSRE---------------------------
A0A2K5VW94_BIK-01       LRENIMRFWRS--PNPRSWVSRE---------------------------
A0A2K6DBJ4_BIK-01       LRENIMRFWRS--PNPRSWVSRE---------------------------
A0A2K5J4Q7_BIK-01       LKENIMRFWRS--PNPGSRVSRE---------------------------
A0A096NKG5_BIK-01       LRENIMRFWRS--PNPRSWVSRE---------------------------
A0A2K5LDM6_BIK-01       LRENIMRFWRS--PNPRSWVSHE---------------------------
A0A2K5XSA1_BIK-01       LRENIMRFWRS--PNPRSWVSRE---------------------------
F1PUF4_BIK-01           LRENI-RIWSF--LTFRNRVSPN---------------------------
H0XAE7_BIK-01           LRENIAGFWRS--LSRGPWVCPA---------------------------
A0A2K6FM79_BIK-01       LREYVARLWRS--LSPRPWVCPA---------------------------
F6RS78_BIK-02           LTNL-----RENIRFWSFLTRRDRVSLRF---------------------
A0A3B1JXK6_BCL2L11      FNDLYFRGAGR-NGGGA--------QLPA---------------------
A0A3B4BVX1_BCL2L11      FNELYFHGVSQLHGCVA--------GMQA---------------------
F6TGJ4_BMF-01           FHRF---------------------HLQR---------------------
G1PAU1_BMF-01           FHRL---------------------QMQQ---------------------
A2AV74_BMF-02           FHRL---------------------HTQQ---------------------
A0A286XXB0_BMF-03       FHRL---------------------HIQQ---------------------
I3MDS9_BMF-02           FHRL---------------------HMQQ---------------------
A0A287AIU8_BMF-05       FHRL---------------------HMQQ---------------------
A0A287AIU8_BMF-01       FHRL---------------------HMQQ---------------------
A0A287AIU8_BMF-04       FHRL---------------------HMQQ---------------------
A0A287AIU8_BMF-03       FHRL---------------------HMQQ---------------------
A0A287AIU8_BMF-02       FHRL---------------------HMQQ---------------------
W5UEE7_BCL2L11-01       FNQLYFHEAERNGGA----------ARPQ---------------------
H9GL49_BMF-01           FHRL---------------------HLQR---------------------
K7FRX2_BMF-01           FHRL---------------------HIQR---------------------
A9XRG9_BMF-02           FHRL---------------------HIQR---------------------
A9XRG9_BMF-01           FHRL---------------------HIQR---------------------
U3JS06_BMF-01           FHRL---------------------HIQR---------------------
H0ZMX5_BMF-01           FHRL---------------------HIQR---------------------
A9XRG9_BMF-03           FHRL---------------------HIQR---------------------
A9XRG9_BMF-04           FHRL---------------------HIQR---------------------
G1NHG8_BMF-01           FHRL---------------------HIQR---------------------
A0A3B4V919_BCL2L11      LKPA---------------------LLKH---------------------
A0A3B4XZH1_BCL2L11      FNRL---------------------LLLR---------------------
A0A337SQV0_BBC3-01      GRPQ---------------------RAVR---------------------
Q9BXH1_BBC3-03          GRPQ---------------------RTVR---------------------
A0A2K5KGR6_BMF-01       LHMG---------------------HQEH---------------------
A0A2K6FFR1_BMF-02       --------------------------------------------------
M3WRS0_BMF-02           --------------------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
F7HPK0_BMF-02           --------------------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
G3QIN5_BMF-02           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
G7PAW6_BMF-01           --------------------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A2AV74_BMF-01           FHRL---------------------HTQQ---------------------
Q8K589_BMF-01           FHRL---------------------HMQQ---------------------
I3MDS9_BMF-01           FHRL---------------------HMQQ---------------------
G3T7Z4_BMF-01           FHRL---------------------HMQR---------------------
F6X3N6_BMF-01           FHRL---------------------HMQR---------------------
G3WDQ2_BMF-01           FHRL---------------------HMQR---------------------
Q96LC9_BMF-06           --------------------------------------------------
F6TJI0_BMF-02           FHRL---------------------HMQQ---------------------
F6TJI0_BMF-01           FHRL---------------------HMQQ---------------------
A0A286XXB0_BMF-02       FHRL---------------------HIQQ---------------------
J9PB65_BMF-01           FHRL---------------------HMQQ---------------------
A0A286XXB0_BMF-01       FHRL---------------------HIQQ---------------------
G1SR62_BMF-01           FHRL---------------------HLQQ---------------------
Q05KI3_BMF-02           FHRL---------------------HMQQ---------------------
Q05KI3_BMF-01           FHRL---------------------HMQQ---------------------
W5QFV1_BMF-01           FHRL---------------------HMQQ---------------------
M3WRS0_BMF-01           FHRL---------------------HMQQ---------------------
M3YAD5_BMF-01           FHRL---------------------HMQQ---------------------
A0A2U4BC98_BMF-01       FHRL---------------------HMQQ---------------------
A0A2K6FFR1_BMF-01       FHRL---------------------HVQQ---------------------
H0WYH6_BMF-01           FHRL---------------------HVQQ---------------------
A0A096NTE9_BMF-01       FHRL---------------------HVQQ---------------------
A0A2K6L933_BMF-02       FHRL---------------------HVQQ---------------------
A0A096NTE9_BMF-02       FHRL---------------------HVQQ---------------------
A0A2K5MJY6_BMF-02       FHRL---------------------HVQQ---------------------
A0A2K5KGR6_BMF-02       FHRL---------------------HVQQ---------------------
G7PAW6_BMF-02           FHRL---------------------HVQQ---------------------
F7CM09_BMF-02           FHRL---------------------HVQQ---------------------
A0A2K6B5G4_BMF-04       FHRL---------------------HVQQ---------------------
A0A2K6B5G4_BMF-02       FHRL---------------------HVQQ---------------------
A0A2K6B5G4_BMF-01       FHRL---------------------HVQQ---------------------
A0A2K5Z4C3_BMF-01       FHRL---------------------HVQQ---------------------
A0A2K6L933_BMF-01       FHRL---------------------HVQQ---------------------
A0A2K6L933_BMF-03       FHRL---------------------HVQQ---------------------
A0A2K6RAW8_BMF-01       FHRL---------------------HVQQ---------------------
A0A0D9R4R5_BMF-01       FHRL---------------------HVQQ---------------------
F7HPK0_BMF-01           FHRL---------------------HVQQ---------------------
A0A2K5E1W9_BMF-01       FHRL---------------------HVQQ---------------------
A0A2K6TW86_BMF-02       FHRL---------------------HVQQ---------------------
A0A2K6TW86_BMF-01       FHRL---------------------HVQQ---------------------
G3QIN5_BMF-01           FHRL---------------------HVQQ---------------------
Q96LC9_BMF-02           FHRL---------------------HVQQ---------------------
Q96LC9_BMF-01           FHRL---------------------HVQQ---------------------
Q96LC9_BMF-04           FHRL---------------------HVQQ---------------------
Q96LC9_BMF-03           FHRL---------------------HVQQ---------------------
A0A2R9BS98_BMF-01       FHRL---------------------HVQQ---------------------
A0A2J8QDD5_BMF-02       FHRL---------------------HVQQ---------------------
A0A2J8T301_BMF-01       FHRL---------------------HVQQ---------------------
A0A3B3VNE0_BCL2L11      YNNHLMVRRMARRHQRNIVPLNLMPHIQQ---------------------
A0A3B3YII5_BCL2L11      YNNHLM--RMARRHQRNIVPLNLMPHIQQ---------------------
A0A3B3YII5_BCL2L11      YNNHLM--RMARRHQRNIVPLNLMPHIQQ---------------------
A0A3B5M375_BCL2L11      ------------------IAVNIGPVLFI---------------------
A0A3B5QAM1_BCL2L11      YNNLLMGRRMARGHQRNIVPLNLMPHIQQ---------------------
A0A3B5QAM1_BCL2L11      YNNLLMGRRMARGHQRNIVPLNLMPHIQQ---------------------
E7FBJ6_BAD-01           FDTWLDKG-VSK--------------TPN---------------------
B5XEF1_BAD-01           FDTWLDKG-VPKRGI----------IPRG---------------------
Q9GL49_PMAIP1-01        NPTRVALPPDPEVEC----------AIQF---------------------
A0A3B4BVX1_BCL2L11      FNELYFHGVSQLHGC----------VAGM---------------------
A0A3B4BVX1_BCL2L11      FNELYFHGAGRNGGR----------VQLP---------------------
I3K7B6_BAD-01           FDSLLDKGEMK-----------------L---------------------
A0A3B4GXJ6_BAD-01       FDSLLDKGEMK-----------------V---------------------
B5X1T1_BAD-01           FDTWLDKGEPKRGIS----------PGGV---------------------
H3ANP3_BAD-03           FD--MSFLGLPRPKS----------AGAA---------------------
H3ANP3_BAD-01           FD--MSFLGLPRPKS----------AGAA---------------------
H3ANP3_BAD-02           FD--MSFLGLPRPKS----------AGAA---------------------
H3ANP3_BAD-04           FD--MSFLGLPRPKS----------AGAA---------------------
H3D8J8_BAD-01           FDSLLDKGGMRKTSS----------AGSA---------------------
A0A3B5L9R9_BAD-01       FVNLLDKGEMRNVSS----------DGSN---------------------
A0A3B1IH05_BAD-01       FDKGLEQG-MKRVRS----------AGAA---------------------
Q4V925_BAD-02           F----DKG-MKRVKS----------AGTA---------------------
Q4V925_BAD-03           F----DKG-MKRVKS----------AGTA---------------------
A7MCM4_BAD-01           F----DKGQMKRVKS----------AGTA---------------------
Q4V925_BAD-04           F----DKGQMKRVKS----------AGTA---------------------
Q4V925_BAD-01           F----DKGQMKRVKS----------AGTA---------------------
A0A3B3BQF7_BAD-01       FDSLLDKGEMRKVRS----------AGAT---------------------
A0A2U9BAC9_BAD-01       FDSLLDKGEMRKVKS----------AGTA---------------------
A0A3B4VFC5_BAD-01       FDSLLDKGEMRKVKS----------AGTA---------------------
A0A3B4W9T1_BAD-01       FDSLLDKGEMRKVKS----------AGTA---------------------
A0A3B3QX41_BAD-01       FDTLLDKG-MKRVRS----------AGAA---------------------
A0A1W4YVX7_BAD-01       FDTLLDKG-MKRVRS----------AGAA---------------------
A0A1W4YVX7_BAD-02       FDTLLDKG-MKRVRS----------AGAA---------------------
A0A3B5K831_BAD-01       FDSLLDKGGMRKTNS----------TGST---------------------
A0A087X8P8_BAD-01       FVNLLDKGEMRKVSS----------TGSN---------------------
A0A3B3UA11_BAD-01       FVNLLDKGEMRKVSS----------TGSN---------------------
A0A3B3YFR1_BAD-01       FVNLLDKGEMRKVSS----------TGSN---------------------
A0A3B5Q2N7_BAD-01       FVNLLDKGEMRNVSS----------DGSN---------------------
A0A3B3HDU2_BAD-01       FDSLLDKGEMRKVRS----------TGAA---------------------
G3Q8B3_BAD-01           FDSLLDKGEMRRVKS----------AGTT---------------------
A0A3B5BAL2_BAD-01       FDSLLDKGEMKRVRS----------AGTA---------------------
A0A2D0SYM2_BAD-01       FDTWLDRGDIRRVSS----------PGKV---------------------
A0A3B4DUY7_BAD-01       FDTWLDKGDTRRASS----------PG-----------------------
A0A2I3HWI8_BBC3-03      LNAQY-------ERR-----------RQE---------------------
A0A2K6FQZ3_BBC3-04      LNAQY-------ERR-----------RQE---------------------
Q9BXH1_BBC3-05          LNAQY-------ERR-----------RQE---------------------
A0A2R9BZA9_BBC3-01      LNAQY-------ERR-----------RQE---------------------
A0A2I3RGH5_BBC3-03      LNAQY-------ERR-----------RQE---------------------
A0A2K5P2T8_BBC3-03      LNAQY-------ERR-----------RQE---------------------
A0A2K5V8J3_BBC3-03      LNAQY-------ERR-----------RQE---------------------
F7FFP6_BBC3-03          LNAQY-------ERR-----------RQE---------------------
A0A2K6ASP2_BBC3-03      LNAQY-------ERR-----------RQE---------------------
A0A2I3N2Z9_BBC3-03      LNAQY-------ERR-----------RQE---------------------
A0A2K6QZU4_BBC3-04      LNAQY-------ERR-----------RQE---------------------
A0A2R8MW85_BBC3-03      LNALY-------ERR-----------RQE---------------------
A0A2K6STD6_BBC3-02      LNAQY-------ERR-----------RQE---------------------
G3T2N1_BBC3-01          LYALY-------ERS----------VRQE---------------------
M3Y0R3_BBC3-01          LNALY-------ERR-----------RQE---------------------
Q99ML1_BBC3-02          LNAQY-------ERR-----------RQE---------------------
Q80ZG6_BBC3-01          LNAQY-------ERR-----------RQE---------------------
H0XQ00_BBC3-01          LNAQY-------ERR-----------RQE---------------------
J9NTK9_BBC3-01          LNALY-------ERR-----------RQE---------------------
A0A337SQV0_BBC3-02      LNALY-------ERR-----------RQE---------------------
F1RM01_BBC3-01          LNALY-------ERR-----------RQE---------------------
A0A2K6FQZ3_BBC3-01      LNAQY-------ERR-----------RQE---------------------
Q9BXH1_BBC3-06          LNAQY-------ERR-----------RQE---------------------
A0A2I3RIG5_BBC3-02      LNAQY-------ERR-----------RQE---------------------
H2NZD3_BBC3-01          LNAQY-------ERR-----------RQE---------------------
A0A2K6QZU4_BBC3-01      LNAQY-------ERR-----------RQE---------------------
A0A0D9S2H2_BBC3-01      LNAQY-------ERR-----------RQE---------------------
B4DQK3_BBC3-01          LNAQY-------ERR-----------RQE---------------------
G1SS60_BAD-01           FEGSVKKG-LPRPKS----------AGTA---------------------
K7E5Y2_BBC3-02          LNALY--------EQ----------RRRE---------------------
A0A337SAW2_BAD-01       FQGSF-KG-LPRPKS----------AGTA---------------------
A0A2I3TBK7_BAD-01       FAPHP-ET-PPVPTA----------LGSH---------------------
A0A2R8Z697_BAD-02       FAPHP-ET-PPVPTA----------LGSH---------------------
A0A2I2Z8C7_BAD-03       FAAHP-ET-PPVPTA----------LGSH---------------------
Q92934_BAD-03           FAPHP-ET-PPVPTA----------LGSH---------------------
A0A2K5M0C1_BAD-02       FAPRP-ET-PPALTV----------LVGH---------------------
A0A2K5XJR2_BAD-02       FAPRP-ET-PPALTV----------LVGH---------------------
A0A2I3MCN5_BAD-03       FAPRP-ET-PPALTV----------LVGH---------------------
A0A2K5VCD8_BAD-02       FAPRP-ET-PPALTV----------LVGH---------------------
F7GVS7_BAD-02           FAPRP-ET-PPALTV----------LVGH---------------------
A0A2K6E7J3_BAD-02       FAPRP-ET-PPALTV----------LVGH---------------------
A0A2K5E6K7_BAD-02       FAPHP-ET-PPVPIA----------LGGH---------------------
A0A2K6TG62_BAD-02       FAPHP-ET-LPAPIA----------LGGH---------------------
A0A2K5E6K7_BAD-03       W---V-AT-APTPQG----------RRRT---------------------
A0A2K5HKW9_BAD-02       WRPGV-AT-APTPRG----------RRRT---------------------
A0A2K6N1A1_BAD-02       WRPGV-AT-APTPRG----------RRRT---------------------
A0A2K6PUM5_BAD-02       WRPGV-AT-APTPRG----------RRRT---------------------
A0A2K5M0C1_BAD-03       WRPGV-AT-APTPRG----------RRRT---------------------
A0A2K5VCD8_BAD-03       WRPGV-AT-APTPRG----------RRRT---------------------
F7GVS7_BAD-03           WRPGV-AT-APTPRG----------RRRT---------------------
A0A2K5XJR2_BAD-03       WRPGV-AT-APTPRG----------RRRT---------------------
A0A2I3MCN5_BAD-02       WRRGV-AT-APTPRG----------RRRT---------------------
A0A2K6E7J3_BAD-03       WRPAV-AT-APTPRG----------RRRT---------------------
A0A2I2Z8C7_BAD-04       WRSGV-AT-APTPRG----------RRTT---------------------
Q92934_BAD-04           WRSGV-AT-APTPRG----------RRTT---------------------
A0A2I3TBK7_BAD-03       WRSGV-AT-APTPRG----------RRTT---------------------
A0A2R8Z697_BAD-03       WRSGV-AT-APTPRG----------RRTT---------------------
F6SJL0_BAD-02           WRPGV-AT-ARTPQG----------RRRT---------------------
A0A2K6TG62_BAD-03       WRHGV-AT-ARTPQG----------RRGT---------------------
G1P8C5_BAD-01           FQGSFKKG-LPRPKS----------AGTA---------------------
W5P8G9_BAD-01           FHVSF-KG-LPRPKS----------AGTA---------------------
G3VRY4_BAD-02           FHCTF-KG-LPRPKS----------AGTA---------------------
G3VRY4_BAD-01           FHCTF-KG-LPRPKS----------AGTA---------------------
I3MBM5_BAD-02           FEGSF-K-------------------------------------------
I3MBM5_BAD-01           FEGSF-KG-LPRPRS----------AGTA---------------------
Q61337_BAD-03           FEGSF-KG-LPRPKS----------AGTA---------------------
Q61337_BAD-01           FEGSF-KG-LPRPKS----------AGTA---------------------
Q61337_BAD-02           FEGSF-KG------------------------------------------
G3TP47_BAD-01           FQGYF-KG-LPRPKS----------AGTA---------------------
F7DN67_BAD-01           FQVSF-QA-LPRPKS----------AGTA---------------------
G1MI17_BAD-01           FQGSF-KG-LPRPKS----------AGTA---------------------
A0A287AEF3_BAD-01       FQGSF-KG-LPRPKS----------AGTA---------------------
O35147_BAD-01           FEGSF-KG-LPRPKS----------AGTA---------------------
M3YNE7_BAD-01           FQGSF-KG-LPRPKS----------AGTA---------------------
F1MUT9_BAD-01           FHVSF-KG-LPRPKS----------AGTA---------------------
Q3SYZ0_BAD-01           FHVSF-KG-LPRPKS----------AGTA---------------------
H0WVR2_BAD-01           FEDSFKKG-LPRPKS----------AGTA---------------------
H0V608_BAD-01           FVDSF-KG-LPRPKS----------AGTA---------------------
A0A2K5E6K7_BAD-01       FVDSF-KG-LPRPKS----------AGTA---------------------
A0A2K6TG62_BAD-01       FVDSF-KG-LPRPKS----------AGTA---------------------
A0A0D9R491_BAD-01       FVDSF-KG-LPRPKS----------AGTA---------------------
A0A2K5M0C1_BAD-01       FVDSF-KG-LPRPKS----------AGTA---------------------
A0A2K5VCD8_BAD-01       FVDSF-KG-LPRPKS----------AGTA---------------------
F7GVS7_BAD-01           FVDSF-KG-LPRPKS----------AGTA---------------------
A0A2K6E7J3_BAD-01       FVDSF-KG-LPRPKS----------AGTA---------------------
A0A2K5XJR2_BAD-01       FVDSF-KG-LPRPKS----------AGTA---------------------
A0A2I3MCN5_BAD-04       FVDSF-KG-LPRPKS----------AGTA---------------------
A0A2K6N1A1_BAD-01       FVDSF-KG-LPRPKS----------AGTA---------------------
A0A2K6PUM5_BAD-01       FVDSF-KG-LPRPKS----------AGTA---------------------
A0A2K5HKW9_BAD-01       FVDSF-KG-LPRPKS----------AGTA---------------------
B4DZQ9_BAD-01           FVDSFKKG-LPRPKS----------AGTA---------------------
A0A2K6GWV0_BAD-01       FEDSFKKG-LPRPKS----------AGTA---------------------
F6SJL0_BAD-01           FVDSFKKG-LPRPKS----------AGTA---------------------
A0A2I3MCN5_BAD-01       FVDSFKKG-LPRPKS----------AGTA---------------------
A0A2I2Z8C7_BAD-02       FVDSFKKG-LPRPKS----------AGTA---------------------
A0A2I2Z8C7_BAD-01       FVDSFKKG-LPRPKS----------AGTA---------------------
Q92934_BAD-01           FVDSFKKG-LPRPKS----------AGTA---------------------
Q92934_BAD-02           FVDSFKKG-LPRPKS----------AGTA---------------------
A0A2I3TBK7_BAD-02       FVDSFKKG-LPRPKS----------AGTA---------------------
A0A2R8Z697_BAD-01       FVDSFKKG-LPRPKS----------AGTA---------------------
A0A2J8TYJ3_BAD-01       FVDSFKKG-LPRPKS----------AGTA---------------------
F1PK10_BAD-01           FQGSF-KG-LPRPKS----------AGTA---------------------
Q45KI9_BAD-01           FQGSF-KG-LPRPKS----------AGTA---------------------
                                                                          

A0A0P0HZF9_PMAIP1-      -------DWKYKLLEIIIALQKAQTDGKR---------------------
Q0GKC8_PMAIP1-01        -------NWKYKLLELIVTLQKIQMEGKR---------------------
A0A3B5RFA9_PMAIP1-      -------YWRYKLLEMLLKNYETLNKIK----------------------
U3IW89_BCL2L11-01       -------------------SCDKATQTPSPPCQAVSH-------------
Q6JTU4_BCL2L11-01       -------------------NAYYARRLEK---------------------
A0A2I3HX97_PMAIP1-      -------NFRQKLLNLISKLFCSGT-------------------------
A0A1D5PAR2_PMAIP1-      -------DLQQKVLNLITKLFCPKT-------------------------
A0A2K6EM90_PMAIP1-      -------HFQQKLLNLIAKLFRSGT-------------------------
G1P8F9_PMAIP1-01        -------SFLQKLLNLMYKLFGSGT-------------------------
G3T0P7_PMAIP1-01        -------NFRQKLLNVICKLFCSGT-------------------------
Q1PCT2_PMAIP1-01        -------NFRQKLLNLLSKLFRSGT-------------------------
G1LIZ7_PMAIP1-01        -------NFRQKLLNLISKLFRSGT-------------------------
A0A2K5NJZ2_PMAIP1-      -------NFRQKLLNLIAKLFCSGT-------------------------
A0A0D9S003_PMAIP1-      -------NFRQKLLNLIAKLFCSGT-------------------------
A0A2K5VPX2_PMAIP1-      -------NFRQKLLNLIAKLFCSGT-------------------------
A0A2K6BV75_PMAIP1-      -------NFRQKLLNLIAKLFCSGT-------------------------
A0A2K5ZWH1_PMAIP1-      -------NFRQKLLNLIAKLFCSGT-------------------------
A0A096MPU8_PMAIP1-      -------NFRQKLLNLIAKLFCSGT-------------------------
A0A2K5JY52_PMAIP1-      -------NFRQKLLNLIAKLFCSGT-------------------------
A0A2K6KJF2_PMAIP1-      -------NFRQKLLNLIAKLFCSGT-------------------------
A0A2K6NC45_PMAIP1-      -------NFRQKLLNLIAKLFCSGT-------------------------
A0A2K6S6C4_PMAIP1-      -------NFRQKLLNLISKLFCSGT-------------------------
A0A2I2YVQ5_PMAIP1-      -------NFRQKLLNLISKLFCSGT-------------------------
Q13794_PMAIP1-01        -------NFRQKLLNLISKLFCSGT-------------------------
A0A2R9AKC9_PMAIP1-      -------NFRQKLLNLISKLFCSGT-------------------------
A0A2I3SX38_PMAIP1-      -------NFRQKLLNLISKLFCSGT-------------------------
H2NWG2_PMAIP1-01        -------NFRQKLLNLISKLFCSGT-------------------------
A0A2K5CFK7_PMAIP1-      -------NFRQKLLNLISKLFCSGT-------------------------
F7GW45_PMAIP1-01        -------NFRQKLLNLISKLFCSGT-------------------------
A0A337SUX1_PMAIP1-      -------NFRQKLMNLISKLFRSGT-------------------------
W5P738_PMAIP1-01        -------NFRQKLVNLIAKLLRSGT-------------------------
A0A287AZR7_PMAIP1-      -------AIRQQITNFIIFFFFLGP-------------------------
G1MV54_BCL2L11-01       --AGNPQVVILRLLHYIIRLIWRMQ-------------------------
G1PDJ5_BCL2L11-01       EAEGHPQMVVLRLLRYILRLVWRRM-------------------------
K7E5Y2_BBC3-01          EEQRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN---------------
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
I3LVX0_BIK-01           ARACRELLPVLLLLGLLLSRALYLRLQ-----------------------
O61667_EGL1-01          SAHASDRSLFHRLLDFFAF-------------------------------
A0A286XF37_PMAIP1-      NFQQKLMYLISKLISLVT--------------------------------
A0A2K5F6X4_BBC3-02      EQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN---------------
A0A337SQV0_BBC3-03      EQQRHRPSPWRVLYNLIMGLLPLPRARGAPEMEPN---------------
Q9JM54_PMAIP1-01        NLRQKLLNLISKLFNLVT--------------------------------
Q5U777_PMAIP1-01        NLRQKLLNFISKLFNLIT--------------------------------
F1SMU1_PMAIP1-01        --------FRQKLLNLIAKLFRLGT-------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
B2KKY9_BCL2L11-01       PNEHAIVLWMNVIIGRLVHFFLRRR-------------------------
B8JK68_BCL2L11-01       PNEHAIVLWMNDIIGRLVHFFLRRR-------------------------
A0A3B3QC78_BCL2L11      PLRPTAMGQGATLTPYPGDNKNKESPLRSRSSWLHVRMGEVEQQEIV---
A0A2K6KS56_BBC3-02      --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       ---DNQAINHQIVLRLLHYIIRLIWRMQ----------------------
G3SU55_BCL2L11-01       AAEDHPQMVILRLLRYIVRLVWR---------------------------
G3W979_BCL2L11-01       AADDHHQMVILRLLHYIIRLVWRMQ-------------------------
Q4KMV9_BCL2L11-01       RPLDNDQVIILRVLRFIIRLILRL--------------------------
F7FTC8_BCL2L11-01       PAGNNHQMGFVHLLRYIIRRVWRLQ-------------------------
A0A2K6E226_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH-------------------------
M3YDI3_BCL2L11-01       AAEAH---PQMIILRLLRYIIRLVWRLQ----------------------
F6XMC1_BCL2L11-02       CHRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQRIISGNILQS
F6XMC1_BCL2L11-01       CHRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQRIISGNILQS
F7CXT2_BCL2L11-01       QGAGDH--HQMVILRLLRYIIRLVWRMQ----------------------
O54918_BCL2L11-01       EAEDH---PQMVILQLLRFIFRLVWRRH----------------------
O88498_BCL2L11-01       EAEDH---PQMVILQLLRFIFRLVWRRH----------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       NSIHP---------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      ADEDH---PQMLILRLLRYIVRLVWRRH----------------------
A0A287DFJ0_BCL2L11      PEDR----PQMVILRLLRCIIRLVWRMH----------------------
A0A286XJN2_BCL2L11      PAEDQ---PQMVILRLLRYIIRLVWRMH----------------------
A0A286XJN2_BCL2L11      PAEDQ---PQMVILRLLRYIIRLVWRMH----------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      AAEDH---PHMVILRLLRYIVRLVWRMH----------------------
A0A2K5CAB2_BCL2L11      AAEDH---PHMVILRLLRYIVRLVWRMH----------------------
F6XMC1_BCL2L11-03       AAEDH---PHMVILRLLRYIVRLVWRMH----------------------
A0A2K6TRZ5_BCL2L11      AAEDH---PHMVILRLLRYIVRLVWRMH----------------------
A0A2K6TRZ5_BCL2L11      AAEDH---PHMVILRLLRYIVRLVWRMH----------------------
A0A2K6QIL2_BCL2L11      AAEEH---PQMVILRLLRYIVRLVWRMH----------------------
A0A2K6QIL2_BCL2L11      AAEEH---PQMVILRLLRYIVRLVWRMH----------------------
A0A2K5NU92_BCL2L11      AAEDH---PQMVILRLLRYIVRLVWRMH----------------------
A0A2K5HZI7_BCL2L11      AAEDH---PQMVILRLLRYIVRLVWRMH----------------------
A0A2K5X2I7_BCL2L11      AAEDH---PQMVILRLLRYIVRLVWRMH----------------------
A0A2K6E226_BCL2L11      AAEDH---PQMVILRLLRYIVRLVWRMH----------------------
A0A2K6E226_BCL2L11      AAEDH---PQMVILRLLRYIVRLVWRMH----------------------
A0A2K5Z8B6_BCL2L11      AAEDH---PQMVILRLLRYIVRLVWRMH----------------------
A0A2I3M6I1_BCL2L11      AAEDH---PQMVILRLLRYIVRLVWRMH----------------------
A0A2K6KJP8_BCL2L11      AAEDH---PQMVILRLLRYIVRLVWRMH----------------------
A0A2K6KJP8_BCL2L11      AAEDH---PQMVILRLLRYIVRLVWRMH----------------------
A0A2I2YQ13_BCL2L11      AAEDH---PRMVILRLLRYIVRLVWRMH----------------------
O43521_BCL2L11-03       AAEDH---PRMVILRLLRYIVRLVWRMH----------------------
A0A2I3HW02_BCL2L11      AAEDH---PRMVILRLLRYIVRLVWRMH----------------------
A0A2R9CA99_BCL2L11      AAEDH---PRMVILRLLRYIVRLVWRMH----------------------
A0A2J8JCT2_BCL2L11      AAEDH---PRMVILRLLRYIVRLVWRMH----------------------
F1SU81_BCL2L11-02       PFSPHTLPPPYI--------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-02       AVEGH---PQMVLLRVLRYIVRLVWRMQ----------------------
W5PY58_BCL2L11-01       AIEGH---PQMVLLRVLRYLVRLVWRMQ----------------------
G1SSY0_BCL2L11-01       AAEEQ---PQMVILRLLRYIVRLVWRMH----------------------
H0XW23_BCL2L11-01       AAEDH---PQMVILRLLRYIVRLVWRLH----------------------
A0A337SW42_BCL2L11      AAEAQ---PQMIILRLLRYIVRLVWRLQ----------------------
G1LDR8_BCL2L11-01       AAEAH---PQMIILRLLRYIVRLVWRLQ----------------------
J9NWV6_BCL2L11-01       AAEAH---PQMIILRLLRYIVRLVWRLQ----------------------
F1SU81_BCL2L11-01       AAEAH---PQMVILRLLRYIARLVWRMQ----------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-08       EAEDHPQMVILQLLRFIFRLVWRRH-------------------------
O54918_BCL2L11-06       EAEDHPQMVILQLLRFIFRLVWRRH-------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       PFSPHTLPPPYI--------------------------------------
A0A2K6GE31_BCL2L11      SI------------------------------------------------
A0A337SW42_BCL2L11      YI------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      ST------------------------------------------------
O43521_BCL2L11-17       ST------------------------------------------------
O43521_BCL2L11-13       ST------------------------------------------------
A0A2I3HW02_BCL2L11      ST------------------------------------------------
A0A2R9CA99_BCL2L11      T-------------------------------------------------
A0A2J8JCT2_BCL2L11      ST------------------------------------------------
A0A2K5NU92_BCL2L11      ST------------------------------------------------
A0A2K5X2I7_BCL2L11      ST------------------------------------------------
F7HHA9_BCL2L11-05       ST------------------------------------------------
A0A2K5Z8B6_BCL2L11      ST------------------------------------------------
A0A2K5HZI7_BCL2L11      ST------------------------------------------------
A0A2K6KJP8_BCL2L11      ST------------------------------------------------
A0A2K6QIL2_BCL2L11      ST------------------------------------------------
A0A2K5CAB2_BCL2L11      FS------------------------------------------------
A0A2K5Z8B6_BCL2L11      FS------------------------------------------------
A0A2K6KJP8_BCL2L11      FS------------------------------------------------
A0A2K6QIL2_BCL2L11      FS------------------------------------------------
F6XMC1_BCL2L11-09       SW------------------------------------------------
A0A2K6TRZ5_BCL2L11      VS------------------------------------------------
A0A2K5HZI7_BCL2L11      FS------------------------------------------------
A0A2R9CA99_BCL2L11      FS------------------------------------------------
A0A2J8JCT2_BCL2L11      FS------------------------------------------------
A0A2K5NU92_BCL2L11      FS------------------------------------------------
A0A2K5X2I7_BCL2L11      FS------------------------------------------------
F7HHA9_BCL2L11-09       FS------------------------------------------------
A0A2K6E226_BCL2L11      FS------------------------------------------------
A0A2I3M6I1_BCL2L11      FS------------------------------------------------
A0A2I2YQ13_BCL2L11      FS------------------------------------------------
O43521_BCL2L11-06       FS------------------------------------------------
O43521_BCL2L11-15       FS------------------------------------------------
A0A2I3HW02_BCL2L11      FS------------------------------------------------
F1SU81_BCL2L11-03       PFSPHTLPPPYI--------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
O54918_BCL2L11-05       EAEDHPQMVILQLLRFIFRLVWRRH-------------------------
O88498_BCL2L11-02       EAEDHPQMVILQLLRFIFRLVWRRH-------------------------
A0A2K6GE31_BCL2L11      ADEDHPQMLILRLLRYIVRLVWRRH-------------------------
A0A286XJN2_BCL2L11      PAEDQPQMVILRLLRYIIRLVWRMH-------------------------
A0A337SW42_BCL2L11      AAEAQPQMIILRLLRYIVRLVWRLQ-------------------------
A0A2K5CAB2_BCL2L11      AAEDHPHMVILRLLRYIVRLVWRMH-------------------------
A0A2K6TRZ5_BCL2L11      AAEDHPHMVILRLLRYIVRLVWRMH-------------------------
A0A2K6QIL2_BCL2L11      AAEEHPQMVILRLLRYIVRLVWRMH-------------------------
A0A2K5NU92_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH-------------------------
A0A2K5HZI7_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH-------------------------
A0A2K5X2I7_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH-------------------------
A0A2K6E226_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH-------------------------
A0A2K5Z8B6_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH-------------------------
A0A2I3M6I1_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH-------------------------
A0A2I3M6I1_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH-------------------------
A0A2K6KJP8_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH-------------------------
A0A2I2YQ13_BCL2L11      AAEDHPRMVILRLLRYIVRLVWRMH-------------------------
O43521_BCL2L11-02       AAEDHPRMVILRLLRYIVRLVWRMH-------------------------
A0A2R9CA99_BCL2L11      AAEDHPRMVILRLLRYIVRLVWRMH-------------------------
A0A2J8JCT2_BCL2L11      AAEDHPRMVILRLLRYIVRLVWRMH-------------------------
H2P5E2_BCL2L11-01       AAEDHPRMVILRLLRYIVRLVWRMH-------------------------
Q2YDF0_BCL2L11-01       AVEGHPQMVLLRVLRYIVRLVWRMQ-------------------------
Q2YDF0_BCL2L11-03       AVEGHPQMVLLRVLRYIVRLVWRMQ-------------------------
A0A287DFJ0_BCL2L11      QPEDRPQMVILRLLRCIIRLVWRMH-------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A3B1JLM2_BAD-01       PGRHTNRGWFSFLWGTKEEEGRE---------------------------
A0A3B4UNJ0_BMF-01       HQRQNLPAWMRLTMALFGFLFPRQALVPRLRGEQR---------------
Q0GKC7_BMF-01           HQRPQDPLWRRVATAVLTLLF-------GARENRR---------------
W5N4P7_BMF-01           NQRNHQPMWWRLALALFTFLFERQGNRNQLRGDQR---------------
A0A3B3RH63_BMF-01       NQRNQQPVWWRLVMALCGLLFER-----RQRAEQR---------------
W5UAU7_BMF-01           NQRNQWPFWLRLASALYALLFDGEPAVHRRRQEDRR--------------
A0A3B1K1X5_BMF-01       NQRNQQPLWLRLASALYTLLFEREPAAHGRREDRR---------------
A0A3B4CNJ8_BMF-01       NQRNQQPFWLRLASALYTLLFEREPVANGRRVDQR---------------
A0A2U9CJH3_BMF-01       NQRNQGPLWWRLAAALLSLLFDRGFLAGGGGAGRRQAHTKRRAKASGPQN
A0A3B5KWG6_BMF-01       NQRNQGPLWWRLGTALLSLLFDRGFVAGGGGAGRR---------------
A0A3B3CGR9_BMF-01       NQRNQGPLWWRLTTALVSLLLDRGFIAGGGGAGQR---------------
A0A3B3I0V9_BMF-04       NQRNQGPVWWRLATALVSLLFDRGFIAGAGGAGQRQSVVSD---------
A0A3B3I0V9_BMF-01       NQRNQGPVWWRLATALVSLLFDRGFIAGAGGAGQR---------------
A0A3B3I0V9_BMF-02       NQRNQGPVWWRLATALVSLLFDRGFIAGAGGAGQR---------------
A0A3B3I0V9_BMF-03       NQRNQGPVWWRLATALVSLLFDRGFIAGAGGAGQR---------------
A0A3B4U5H8_BMF-01       NQRNQGPLWWRLAVALLSLLFDRGLIAGGGGAGRR---------------
A0A3B4WM88_BMF-01       NQRNHGPLWWRLAAALLSLLFDRGLIAGGGGAGRR---------------
I3K2D6_BMF-01           NQRNQGPMWWRLAAALLSLLFDRGFIAGGGGGGRR---------------
A0A3B4ETH0_BMF-01       NQRNQGPMWWRLAAAILSLLFDRGFIAGGGGGGRR---------------
A0A3B5B8F6_BMF-01       NQRNQGPLWWRLAAALLSLLFDRGFIAGGGGAGRR---------------
A0A096LRV0_BMF-01       NQRNQGPLWWRMTAALLSLLFHRGFIAGGGGAGRR---------------
A0A3B3WU80_BMF-01       NQRNQGPLWWRMTAALLSLLFHRGFIAGGGGAGRR---------------
A0A3B5QK08_BMF-02       NQRNQGPLWWRMTAALLSLLFDRGFIAGGGGAGRR---------------
A0A3B5QK08_BMF-01       NQRNQGPLWWRMTAALLSLLFDRGFIAGGGGAGRR---------------
F6RS78_BIK-01           GCHSPHQSLLSSFACFTHSSSCLFPGPLGLRWLAY---------------
A0A2K5JY52_PMAIP1-      ARLHCN--------------------------------------------
A0A096MPU8_PMAIP1-      ERLHCNW-------------------------------------------
A0A2K5ZWH1_PMAIP1-      ERLHCNW-------------------------------------------
A0A2K5VPX2_PMAIP1-      ERLHCNW-------------------------------------------
A0A2K6BV75_PMAIP1-      ERLHCNW-------------------------------------------
A0A2K6KJF2_PMAIP1-      ERLHCNW-------------------------------------------
A0A2K6NC45_PMAIP1-      ERLHCNW-------------------------------------------
Q13794_PMAIP1-02        ERLHCN--------------------------------------------
A0A2R9AKC9_PMAIP1-      ERLHCNW-------------------------------------------
A0A1D5QGJ8_PMAIP1-      ERLHCN--------------------------------------------
A0A2I2YVQ5_PMAIP1-      ERLHCNWEECEGAFMGALGNGRWNTSK-----------------------
A0A2I3SX38_PMAIP1-      ERLHCNW-------------------------------------------
C1C3S9_BAD-01           EMTVSKSFGETFFNFFRRKNKDRSQSENDKH-------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
F6Z067_BAD-01           GQMTGNRSIRDLIMGLFSRRKSKGRDESGDEE------------------
M3XHJ5_BCL2L11-01       QTPSPSSQLIVHVQHCLAQREQHPETHGKNPLNFT---------------
W5QCU2_BIK-01           --LWPELALSLLVVAMLS---------WGCRF------------------
O70337_BIK-04           QDPGQLFPMVLLVFLLLG---------GAWYLQLQ---------------
O70337_BIK-02           QDPGQLFPMVLLVFLLLG---------GAWYLQLQ---------------
O70337_BIK-01           QDPGQLFPMVLLVFLLLG---------GAWYLQLQ---------------
Q925D2_BIK-01           QDPGQLFPMVLLVFLLLG---------GAWHLQLQ---------------
G1TZR9_BIK-01           PLPGQGWPPSWRVVLLGA---------GSWGLRMP---------------
H0W025_BIK-01           WTCRWLLPVLLLLLLLL----------GTLRLLLQ---------------
A0A2K5CLG5_BIK-01       QAVL--LALLALLLAMFS---------GGLHLLLK---------------
F7FUT7_BIK-01           QAVL--LALLALLLAMFS---------GGLHLLLK---------------
A0A2K6TBD7_BIK-01       QAVL--LALLALLLAMFS---------GGLRLLLK---------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           QMLLVLLVLLLLLLPLLS---------GGLYLLN----------------
G3QCT2_BIK-01           QVLLALLLLLALLLPLLS---------GGLHLLLK---------------
A0A2R8ZXD2_BIK-01       QVLLALLLLLALLLPLLS---------GGLHLLLK---------------
H2QLU7_BIK-01           QVLLALLLLLALLLPLLS---------GGLHLLLK---------------
Q13323_BIK-01           QVLLALLLLLALLLPLLS---------GGLHLLLK---------------
A0A2K6MCW0_BIK-01       QVLLALLLLLA---ALLS---------GGLHLLLK---------------
A0A2K6QK74_BIK-01       QVLLALLLLLA---ALLS---------GGLHLLLK---------------
A0A0D9QZY8_BIK-01       QVLLALL-LLALLLALLS---------GGLHLLLK---------------
A0A2K5VW94_BIK-01       QVLLVLLLLLALLLALLS---------GGLHLLLK---------------
A0A2K6DBJ4_BIK-01       QVLLVLLLLLALLLALLS---------GGLHLLLK---------------
A0A2K5J4Q7_BIK-01       QVLLALLLLLALLLALLS---------GGLHLLLK---------------
A0A096NKG5_BIK-01       QVLLALLLLLALLLALLS---------GGLHLLLK---------------
A0A2K5LDM6_BIK-01       QVLL----LLALLLALLS---------GGLHLLLK---------------
A0A2K5XSA1_BIK-01       QVLL----LLALLLALLS---------GGLHLLLK---------------
F1PUF4_BIK-01           PGRGLVLSLLLLLVLLLG---------WGLRLLQ----------------
H0XAE7_BIK-01           PAWEQVLLLLLLLVLLLA---------GGLHLLLK---------------
A0A2K6FM79_BIK-01       PAWEQVLLLLLVL-LLLG---------GGLHLLLK---------------
F6RS78_BIK-02           HDLDSPSCMCSPLEPWSSCPVGHSLAGCHSPHQSLLSSFACFTHSSSCLF
A0A3B1JXK6_BCL2L11      QNEPAFILWMGLLIERLRQFLHRRR-------------------------
A0A3B4BVX1_BCL2L11      LSNPVAFSILGLF---------RGH-------------------------
F6TGJ4_BMF-01           LQQNRNQFWSQILIFF------RNLVMHPVGNRAGLAQR-----------
G1PAU1_BMF-01           HQQNRNRMWWQFLLFL------HNLALNGDENRNGAGPR-----------
A2AV74_BMF-02           HQQNRDRAWWQVFLFL------QNLALNRQENREGVGPW-----------
A0A286XXB0_BMF-03       HQQNRNRAWWQVLLFM------HNLGLNGEENREGAGPR-----------
I3MDS9_BMF-02           HQQNRNRVWWQILLFL------HNLALNGDENRDRAGPR-----------
A0A287AIU8_BMF-05       EFPS----WLG---------------------------------------
A0A287AIU8_BMF-01       HQQNQNRVWWQILLFL------HNLALHGDENRNGAGPR-----------
A0A287AIU8_BMF-04       HQQNQNRVWWQILLFL------HNLALHGDENRNGAGPR-----------
A0A287AIU8_BMF-03       HQQNQNRVWWQILLFL------HNLALHGDENRNGAGPR-----------
A0A287AIU8_BMF-02       HQQNQNRVWWQILLFL------HNLALHGDENRNGAGPR-----------
W5UEE7_BCL2L11-01       AQNEPAIMLWIGLLIG------RLLQFFLRQR------------------
H9GL49_BMF-01           HQQNRNQVWWQIFFFL------HNVALNMEANRHRAGRSCTTTYFPFTEP
K7FRX2_BMF-01           HQQNRNQVWWQILLFL------HNLALNVEANRNHIGQR-----------
A9XRG9_BMF-02           VGCFHRGRWGLSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ----------
A9XRG9_BMF-01           VGCFHRGRWGLSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ----------
U3JS06_BMF-01           HQQNRNQVWWQLFLFL------HNLALNTEVNRNHTGQR-----------
H0ZMX5_BMF-01           HQQNRNQVWWQLFLFL------HNLALNTEVNRNHTGQR-----------
A9XRG9_BMF-03           HQQNRNQVWWQLFLFL------HNLALNVEANRNRTGQR-----------
A9XRG9_BMF-04           HQQNRNQVWWQLFLFL------HNLALNVEANRNRTGQR-----------
G1NHG8_BMF-01           HQQNRNQVWWQLFLFL------HNLALNVEANRNRTGQR-----------
A0A3B4V919_BCL2L11      TKMTSQCCQTHFC-------------------------------------
A0A3B4XZH1_BCL2L11      VSHHRWCVCVCVCVCA------CGCVCACGCVCGCVRVCGGGGGVE----
A0A337SQV0_BBC3-01      AAETRGAAATPPLTLE------GPVQSHHGTPALTQGPRGPGDGAQLGAC
Q9BXH1_BBC3-03          AAETRGAAAAPPLTLE------GPVQSHHGTPALTQGPQSPRDGAQLGAC
A0A2K5KGR6_BMF-01       RQEGHRAGLTLCLVKL------FFCCYFAF--------------------
A0A2K6FFR1_BMF-02       --------------------------------------------------
M3WRS0_BMF-02           --------------------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
F7HPK0_BMF-02           --------------------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
G3QIN5_BMF-02           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
G7PAW6_BMF-01           --------------------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A2AV74_BMF-01           HQQNRDRAWWQVFLFL------QNLALNRQENREGVGPW-----------
Q8K589_BMF-01           HQQNRDRAWRQVFLFL------QNLALNRRENREGVGPW-----------
I3MDS9_BMF-01           HQQNRNRVWWQILLFL------HNLALNGDENRDRAGPR-----------
G3T7Z4_BMF-01           HQQNRNPAWRQILQFL------HHLAVNGEENRNGAGPR-----------
F6X3N6_BMF-01           HQQNRNHVWWQILLFL------HNLALNREENRNGAGPR-----------
G3WDQ2_BMF-01           HQQNQNHVWWQILLFL------HNLALNREENRNGAGPR-----------
Q96LC9_BMF-06           HQQNQNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
F6TJI0_BMF-02           HQQNRNRVWWQTLLFL------HNLALNGDENRNGAGPSFQPGQEGVLWK
F6TJI0_BMF-01           HQQNRNRVWWQTLLFL------HNLALNGDENRNGAGPRCGKNVRGPVRE
A0A286XXB0_BMF-02       HQQNRNRAWWQVLLFM------HNLGLNGEENREGAGPR-----------
J9PB65_BMF-01           HQQNQNRVWWQILLFL------HNLALNADENRNGAGPSFQLVPGISCSG
A0A286XXB0_BMF-01       HQQNRNRAWWQVLLFM------HNLGLNGEENREGAGPR-----------
G1SR62_BMF-01           HQQNRNRVWWQILLFL------HNLALNGDENRDGAGPR-----------
Q05KI3_BMF-02           YQQNRNRMWWQILLFL------HNVALNGDENRNGAGPR-----------
Q05KI3_BMF-01           YQQNRNRMWWQILLFL------HNVALNGDENRNGAGPR-----------
W5QFV1_BMF-01           HQQNRNRMWWQILLFL------HNVALNGDENRNGAGPR-----------
M3WRS0_BMF-01           HQQNRRRVWWQILLFL------HNLALNAEENRNGAGPR-----------
M3YAD5_BMF-01           HQQNQNRVWWQILLFL------HNLALNADENRNGAGPR-----------
A0A2U4BC98_BMF-01       HQQNRNRVWWQILLFL------HNLALNGDENRNGAGPR-----------
A0A2K6FFR1_BMF-01       HQQNQNRMWWQILLFL------HNLALNGEENRNGAGPR-----------
H0WYH6_BMF-01           HQQNQNRVWWQVLFFL------HNLALNGEENRNGAGPR-----------
A0A096NTE9_BMF-01       HQQNRNRVWWQILLFL------HNLALNGEENRNGVDPRYKNARRSVRKL
A0A2K6L933_BMF-02       HQQNRNRVWWQILLFL------HNLALNGEENRNGAGPRPLTWNGGRCQT
A0A096NTE9_BMF-02       HQQNRNRVWWQILLFL------HNLALNGEENRNGVDPRPLTWNGAVVKP
A0A2K5MJY6_BMF-02       HQQNRNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
A0A2K5KGR6_BMF-02       HQQNRNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
G7PAW6_BMF-02           HQQNRNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
F7CM09_BMF-02           HQQNRNRVWWQILLFL------HNLALNGEQNRNGAGPR-----------
A0A2K6B5G4_BMF-04       HQQNRNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
A0A2K6B5G4_BMF-02       HQQNRNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
A0A2K6B5G4_BMF-01       HQQNRNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
A0A2K5Z4C3_BMF-01       HQQNRNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
A0A2K6L933_BMF-01       HQQNRNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
A0A2K6L933_BMF-03       HQQNRNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
A0A2K6RAW8_BMF-01       HQQNRNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
A0A0D9R4R5_BMF-01       HQQNRNRMWWQILLFL------HNLALNGEENRNGAGPR-----------
F7HPK0_BMF-01           HQQNRNRMWWQVLLFL------HNLALNGEENRNGAGPR-----------
A0A2K5E1W9_BMF-01       HQQNRNRVWWQVLLFL------HNLALNGEENRNGAGPR-----------
A0A2K6TW86_BMF-02       HQQNRNRVWWQVLLFL------HNLALNGEENRNGAGPR-----------
A0A2K6TW86_BMF-01       HQQNRNRVWWQVLLFL------HNLALNGEENRNGAGPR-----------
G3QIN5_BMF-01           HQQNQNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
Q96LC9_BMF-02           HQQNQNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
Q96LC9_BMF-01           HQQNQNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
Q96LC9_BMF-04           HQQNQNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
Q96LC9_BMF-03           HQQNQNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
A0A2R9BS98_BMF-01       HQQNQNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
A0A2J8QDD5_BMF-02       HQQNQNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
A0A2J8T301_BMF-01       HQQNRNRVWWQILLFL------HNLALNGEENRNGAGPR-----------
A0A3B3VNE0_BCL2L11      EPVAMLCVCLLLLLVG------RIMYMQGNTSSHDHSQV-----------
A0A3B3YII5_BCL2L11      EPVAMLCVCLLLLLVG------RIMYMQGNTSSHDHSQV-----------
A0A3B3YII5_BCL2L11      EPVAMLCVCLLLLLVG------RIMYMQGNTSSHDHSQV-----------
A0A3B5M375_BCL2L11      RPIPML-VPIYHASTL------RISALE----------------------
A0A3B5QAM1_BCL2L11      EPVAMLCVCLLLLLVG------RIMYMQGNTSSHDHSQV-----------
A0A3B5QAM1_BCL2L11      EPVAMLCVCLLLLLVG------RIMYMQGNTSSHDHSQV-----------
E7FBJ6_BAD-01           SQKQTYRGWFSFLWSPKEEEGRE---------------------------
B5XEF1_BAD-01           GKQKVSRGWFSFLWSPKEAEGRE---------------------------
Q9GL49_PMAIP1-01        RRIGDKLNFRQKLLNLIAKLFRLGT-------------------------
A0A3B4BVX1_BCL2L11      Q----------ALSARDLHDQMFALS------------------------
A0A3B4BVX1_BCL2L11      AEEEPAFMLWLGLVIRRLLEVLLRRR------------------------
I3K7B6_BAD-01           KKLHHSKTWWSYLFSHQETEGENN--HLE---------------------
A0A3B4GXJ6_BAD-01       KKLHHSKTWWSYLFSHQETEGENN--HLENHNQRTE--------------
B5X1T1_BAD-01           KQ-EVSRGWFSFLWSPKKAEGRE---------------------------
H3ANP3_BAD-03           GEMVDE-SWWKKLIRSLKGRGQPR-------DPPGQ--------------
H3ANP3_BAD-01           GEMVDE-SWWKKLIRSLKGRGQPR-------DPPGQQGVSIRGPD-----
H3ANP3_BAD-02           GEMVDE-SWWKKLIRSLKGRGQPR-------DPPGQQGVSIRGPD-----
H3ANP3_BAD-04           GEMVDE-SWWKKLIRSLKGRGQPR-------DPPGQ--------------
H3D8J8_BAD-01           RQMHHSRSWWSYLFSHQETESENN--HHD---------------------
A0A3B5L9R9_BAD-01       RPIHHSRSWWSYLFSHQETEGENN--HHENHASRTE--------------
A0A3B1IH05_BAD-01       RQMQNSPSWFAFLWSHKESDSEAS------SSRPAE--------------
Q4V925_BAD-02           RQMSQSPSWLAFLWSHKESDAESR---------PAE--------------
Q4V925_BAD-03           RQMSQSPSWLAFLWSHKESDAESR---------PAE--------------
A7MCM4_BAD-01           RQMSQSPSWLAFLWSHKESDAESR---------PAE--------------
Q4V925_BAD-04           RQMSQSPSWLAFLWSHKESDAESR---------PAE--------------
Q4V925_BAD-01           RQMSQSPSWLAFLWSHKESDAESR---------PAE--------------
A0A3B3BQF7_BAD-01       KQMHHSTSWWNYLFSHPEAEGEYS--HHESH--RTE--------------
A0A2U9BAC9_BAD-01       RQMHHSQSWWSYLFSHQEMEGENN--HHENHTQRNE--------------
A0A3B4VFC5_BAD-01       KQMHHSKSWWSYLFSHQETEGENN--HHENHTHRTE--------------
A0A3B4W9T1_BAD-01       KQMHHSKSWWSYLFSHQETEGENN--HHENHTHRTE--------------
A0A3B3QX41_BAD-01       RQMQASPSWFAFLWSHKESDAEISGSLSTADSRAAQ--------------
A0A1W4YVX7_BAD-01       RQMQASPSWFAFLWSHKESEAEIS-----SGGRAAQ--------------
A0A1W4YVX7_BAD-02       RQMQASPSWFAFLWSHKESEAEIS-----SGGRAAQ--------------
A0A3B5K831_BAD-01       KPMHHSRSWWSYLFSHQETEGENG--HHDGHTHRTE--------------
A0A087X8P8_BAD-01       RPIHHSRSWWSYLFSHQETEGENN--HHENHASRTE--------------
A0A3B3UA11_BAD-01       RPIHHSRSWWSYLFSHQETEGENN--HHENHASRTE--------------
A0A3B3YFR1_BAD-01       RPIHHSRSWWSYLFSHQETEGENN--HHENHASRTE--------------
A0A3B5Q2N7_BAD-01       RPIHHSRSWWSYLFSHQETEGENN--HHENHASRTE--------------
A0A3B3HDU2_BAD-01       KQMLHSTSWWNYLFSHPEAEGEYS--HHE--SHRTE--------------
G3Q8B3_BAD-01           KQMQHSKSWWSSLFSHQEMEGENN--HHE---------------------
A0A3B5BAL2_BAD-01       KQMHHSKSWWSYLFSHQELEGENN--HHENHTHRNE--------------
A0A2D0SYM2_BAD-01       SQKQSNRGWFSFL-----------WGSREEEEEGRE--------------
A0A3B4DUY7_BAD-01       --KQTNRGWFSFL-----------WGSK--EEEGRE--------------
A0A2I3HWI8_BBC3-03      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A2K6FQZ3_BBC3-04      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
Q9BXH1_BBC3-05          EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A2R9BZA9_BBC3-01      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A2I3RGH5_BBC3-03      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A2K5P2T8_BBC3-03      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A2K5V8J3_BBC3-03      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
F7FFP6_BBC3-03          EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A2K6ASP2_BBC3-03      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A2I3N2Z9_BBC3-03      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A2K6QZU4_BBC3-04      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A2R8MW85_BBC3-03      EQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN---------------
A0A2K6STD6_BBC3-02      EQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN---------------
G3T2N1_BBC3-01          EQHRHRPSPWRVLYNLIMGLLPLPRDHGAPEMEPN---------------
M3Y0R3_BBC3-01          EQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN---------------
Q99ML1_BBC3-02          EQHRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN---------------
Q80ZG6_BBC3-01          EQHRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN---------------
H0XQ00_BBC3-01          EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
J9NTK9_BBC3-01          EQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN---------------
A0A337SQV0_BBC3-02      EQQRHRPSPWRVLYNLIMGLLPLPRARGAPEMEPN---------------
F1RM01_BBC3-01          EQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN---------------
A0A2K6FQZ3_BBC3-01      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
Q9BXH1_BBC3-06          EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A2I3RIG5_BBC3-02      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
H2NZD3_BBC3-01          EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A2K6QZU4_BBC3-01      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A0D9S2H2_BBC3-01      EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
B4DQK3_BBC3-01          EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
G1SS60_BAD-01           MQMRESSSWTRVIQSWWDRNLG--KGGSAPSQ------------------
K7E5Y2_BBC3-02          EEQRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN---------------
A0A337SAW2_BAD-01       TQMRQSPSWTRFIQSWWDRNLG--RGGSAPSQ------------------
A0A2I3TBK7_BAD-01       LEYGRKYFPQAYAK----------RGSVLSPLEGGLTPIPFRCV------
A0A2R8Z697_BAD-02       LEYGRKYFPQAYAK----------RGSVLSPLEGGLTQIPFRCV------
A0A2I2Z8C7_BAD-03       LEYGRKYFPQAYAK----------RGSVLSPLEGRLTQIPFRCV------
Q92934_BAD-03           LEYGRKYFPQAYAK----------RGSVLSPLEGGLTQIPFRCV------
A0A2K5M0C1_BAD-02       LGYGRKCFPQALCK----------RGSVLPLSVGGLTQIPFRCM------
A0A2K5XJR2_BAD-02       LGYGRKCFPQASCK----------RGSVLPLSVGGLTQIPFRCM------
A0A2I3MCN5_BAD-03       LGYGRKCFPQALCK----------RGSVLPLSVGGLTQIPFRCM------
A0A2K5VCD8_BAD-02       LGYGRKCFPQALCK----------RGSVLPLSVGGLTQIPFRCM------
F7GVS7_BAD-02           LGYGRKCFPQALCK----------RGSVLPLSVGGLTQIPFRCM------
A0A2K6E7J3_BAD-02       LGYGRKCFPQALCK----------RGSVLPLSVGGLTQIPFRCM------
A0A2K5E6K7_BAD-02       LGYGRKCFLQ-----------------------GELTQIPFRCV------
A0A2K6TG62_BAD-02       LGHGRKCFLQ-----------------------GGLTQIPFRCV------
A0A2K5E6K7_BAD-03       KGWRRSPAPFGAVRAQHPPTSG--QHSAMAASSGG---------------
A0A2K5HKW9_BAD-02       KGWRRSPAPFGAARAPRPLTSG--QHSDMAASSGG---------------
A0A2K6N1A1_BAD-02       KGWRRSPAPFGAARAPRPLTSG--QHSDMAASSGG---------------
A0A2K6PUM5_BAD-02       KGWRRSPAPFGAARAPRPLTSG--QHSDMAASSGG---------------
A0A2K5M0C1_BAD-03       KGWRRSPAPFGAARAPRPPTSG--QHSVMAASSGG---------------
A0A2K5VCD8_BAD-03       KGWRRSPAPFGAARAPRPPTSG--QHSVMAASSGG---------------
F7GVS7_BAD-03           KGWRRSPAPFGAARAPRPPTSG--QHSVMAASSGG---------------
A0A2K5XJR2_BAD-03       KGWRRSPAPFGAARAPRPPTSG--QHSVMAASSGG---------------
A0A2I3MCN5_BAD-02       KGWRRSPAPFGAARAPRPPTSG--QHSVMAASSGG---------------
A0A2K6E7J3_BAD-03       KGWRRSPAPFGAARAPRPPTSG--QHSVMAASSGG---------------
A0A2I2Z8C7_BAD-04       KGWGRSPAPFGAARARRPPTSG--QHSAMAASSGG---------------
Q92934_BAD-04           KGWGRSPAPFGAARARRPPTSG--QHSAMAASSGG---------------
A0A2I3TBK7_BAD-03       KGWGRSPAPFGAARARRPPTSG--QHSAMAASSGG---------------
A0A2R8Z697_BAD-03       KGWGRSPAPFGAARARRPPTSG--QHSAMAASSGG---------------
F6SJL0_BAD-02           KGWRRSPAPFGAVRARHPPTSG--QHSAMAASSGG---------------
A0A2K6TG62_BAD-03       KGWRRSPALFGAVRARHPPTSG--QHSDMAASSGG---------------
G1P8C5_BAD-01           TQMWQKSSWTRFFQSWWDRNSG--RGGSAPSQ------------------
W5P8G9_BAD-01           TQMRQSPSWTRFLQSWLSRNLG--RGGSAPSQ------------------
G3VRY4_BAD-02           SQMRRSHGWTRTFQSWFGRNLG--KGSVGPSH------------------
G3VRY4_BAD-01           SQMRRSHGWTRTFQSWFGRNLG--KGSVGPSH------------------
I3MBM5_BAD-02           ---------VTFSQSPFLRA------------------------------
I3MBM5_BAD-01           SQMRQSSSWTRFIQSWWDRNLG--RRGSAPSQ------------------
Q61337_BAD-03           TQMRQSAGWTRIIQSWWDRNLG--KGGSTPSQ------------------
Q61337_BAD-01           TQMRQSAGWTRIIQSWWDRNLG--KGGSTPSQ------------------
Q61337_BAD-02           EELTYSLSPFRCVQ------------------------------------
G3TP47_BAD-01           TQMRQSPSWTRIIQAWWDRNLG--RGSSAPSQ------------------
F7DN67_BAD-01           TQMRQSPSWTRAIQSWWDRNLG--RGGSAPSQ------------------
G1MI17_BAD-01           TQMRQSPSWTRVIQSWWDRNLG--RGGSAPSQ------------------
A0A287AEF3_BAD-01       TQMRQSPSWKRFLQSWWYRNSG--RGGPAPSQ------------------
O35147_BAD-01           TQMRQSASWTRIIQSWWDRNLG--KGGSTPSQ------------------
M3YNE7_BAD-01           TQMRQSPSWTRVIQSWWDRNLG--RGGSAPSQ------------------
F1MUT9_BAD-01           TQMRQSPSWTRFLQSWLSRNLG--RGGSAPSQ------------------
Q3SYZ0_BAD-01           TEMRQSPSWTRFLQSWLSRNLG--RGGSAPSQ------------------
H0WVR2_BAD-01           TQMRQSSSWTRVIQSWWDRNVG--RGGSAPCQ------------------
H0V608_BAD-01           TKLWQNSNWTRAIQSWWDRNLG--RGGSAPSQESV---------------
A0A2K5E6K7_BAD-01       TQMRQSSSWTQVIQSWWDRNLG--RGGSAPSQ------------------
A0A2K6TG62_BAD-01       TQMRQSSSWTRVIQSWWDRNLG--RGGSAPSQ------------------
A0A0D9R491_BAD-01       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
A0A2K5M0C1_BAD-01       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
A0A2K5VCD8_BAD-01       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
F7GVS7_BAD-01           TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
A0A2K6E7J3_BAD-01       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
A0A2K5XJR2_BAD-01       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
A0A2I3MCN5_BAD-04       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
A0A2K6N1A1_BAD-01       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
A0A2K6PUM5_BAD-01       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
A0A2K5HKW9_BAD-01       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
B4DZQ9_BAD-01           TQMRQSPRRLR---------------------------------------
A0A2K6GWV0_BAD-01       TQIRQSSSWTRVIQSWWDRNVG--RGGSAPSQ------------------
F6SJL0_BAD-01           TQMRQSSSWTRVIQSWWDRNLG--RGGSAPSQ------------------
A0A2I3MCN5_BAD-01       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
A0A2I2Z8C7_BAD-02       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
A0A2I2Z8C7_BAD-01       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
Q92934_BAD-01           TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
Q92934_BAD-02           TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
A0A2I3TBK7_BAD-02       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
A0A2R8Z697_BAD-01       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
A0A2J8TYJ3_BAD-01       TQMRQSSSWTRVFQSWWDRNLG--RGSSAPSQ------------------
F1PK10_BAD-01           TQMRQSPSWTRVIQSWWDRNLG--RGGSAPSQ------------------
Q45KI9_BAD-01           TQMRQSPSWTRVIQSWWDRNLG--RGGSAPSQ------------------
                                                                          

A0A0P0HZF9_PMAIP1-      --------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------
U3IW89_BCL2L11-01       --------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------
Q13794_PMAIP1-01        --------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------
F7GW45_PMAIP1-01        --------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------
W5P738_PMAIP1-01        --------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------
G1MV54_BCL2L11-01       --------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------
K7E5Y2_BBC3-01          --------------------------------------
A9XRH0_BMF-01           --------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------
A3KND0_BMF-01           --------------------------------------
Q6P7C5_BAD-01           --------------------------------------
A0A287AEF3_BAD-02       --------------------------------------
I3LVX0_BIK-01           --------------------------------------
O61667_EGL1-01          --------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------
Q5U777_PMAIP1-01        --------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------
Q9BXH1_BBC3-04          --------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------
B8JK68_BCL2L11-01       --------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------
F7G1G0_HRK-01           --------------------------------------
P62816_HRK-03           --------------------------------------
P62817_HRK-01           --------------------------------------
A0A287A5N9_HRK-01       --------------------------------------
H2NIS8_HRK-01           --------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------
H2Q6Y8_HRK-01           --------------------------------------
G3UH24_HRK-01           --------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------
U3E722_HRK-01           --------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------
A0A337SQ56_HRK-01       --------------------------------------
G3QTJ6_HRK-01           --------------------------------------
O00198_HRK-01           --------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------
G1QHD8_HRK-01           --------------------------------------
G1T7W1_HRK-01           --------------------------------------
H0Y001_HRK-01           --------------------------------------
A0A096N944_HRK-01       --------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------
E2RLD4_HRK-01           --------------------------------------
F7GVS7_BAD-04           --------------------------------------
Q2PG01_BAD-01           --------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------
K7GA86_BCL2L11-01       --------------------------------------
G3SU55_BCL2L11-01       --------------------------------------
G3W979_BCL2L11-01       --------------------------------------
Q4KMV9_BCL2L11-01       --------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------
F6XMC1_BCL2L11-02       VARWCQMMLTPQLYLVLKDGGPVVKSALKLPWFHSPVA
F6XMC1_BCL2L11-01       VARWCQMMLTPQLYLVLKDGGPVVKSALKLPWFHSPVA
F7CXT2_BCL2L11-01       --------------------------------------
O54918_BCL2L11-01       --------------------------------------
O88498_BCL2L11-01       --------------------------------------
A0A337SW42_BCL2L11      --------------------------------------
A0A337SW42_BCL2L11      --------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------
O43521_BCL2L11-22       --------------------------------------
O43521_BCL2L11-08       --------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------
O43521_BCL2L11-24       --------------------------------------
O43521_BCL2L11-12       --------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------
O43521_BCL2L11-21       --------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------
O43521_BCL2L11-16       --------------------------------------
O43521_BCL2L11-09       --------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------
O43521_BCL2L11-18       --------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------
F6XMC1_BCL2L11-03       --------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------
O43521_BCL2L11-03       --------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------
F1SU81_BCL2L11-02       --------------------------------------
A0A337SW42_BCL2L11      --------------------------------------
Q2YDF0_BCL2L11-02       --------------------------------------
W5PY58_BCL2L11-01       --------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------
H0XW23_BCL2L11-01       --------------------------------------
A0A337SW42_BCL2L11      --------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------
J9NWV6_BCL2L11-01       --------------------------------------
F1SU81_BCL2L11-01       --------------------------------------
O43521_BCL2L11-11       --------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------
O54918_BCL2L11-08       --------------------------------------
O54918_BCL2L11-06       --------------------------------------
O54918_BCL2L11-03       --------------------------------------
O43521_BCL2L11-07       --------------------------------------
O43521_BCL2L11-19       --------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------
O43521_BCL2L11-23       --------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------
A0A337SW42_BCL2L11      --------------------------------------
O43521_BCL2L11-10       --------------------------------------
O43521_BCL2L11-20       --------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------
O43521_BCL2L11-17       --------------------------------------
O43521_BCL2L11-13       --------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------
O43521_BCL2L11-06       --------------------------------------
O43521_BCL2L11-15       --------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------
F1SU81_BCL2L11-03       --------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------
O43521_BCL2L11-05       --------------------------------------
O43521_BCL2L11-25       --------------------------------------
O54918_BCL2L11-05       --------------------------------------
O88498_BCL2L11-02       --------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------
A0A337SW42_BCL2L11      --------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------
O43521_BCL2L11-02       --------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------
Q2YDF0_BCL2L11-03       --------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------
A0A3B1JLM2_BAD-01       --------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------
Q0GKC7_BMF-01           --------------------------------------
W5N4P7_BMF-01           --------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------
W5UAU7_BMF-01           --------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------
A0A2U9CJH3_BMF-01       RASSVERTVQAMTNQFTSLPPQQLPPPANGRLPCALIG
A0A3B5KWG6_BMF-01       --------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------
A0A3B3I0V9_BMF-04       --------------------------------------
A0A3B3I0V9_BMF-01       --------------------------------------
A0A3B3I0V9_BMF-02       --------------------------------------
A0A3B3I0V9_BMF-03       --------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------
I3K2D6_BMF-01           --------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------
A0A096LRV0_BMF-01       --------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------
F6RS78_BIK-01           --------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------
Q13794_PMAIP1-02        --------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------
A0A1D5QGJ8_PMAIP1-      --------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------
C1C3S9_BAD-01           --------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------
F6Z067_BAD-01           --------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------
W5QCU2_BIK-01           --------------------------------------
O70337_BIK-04           --------------------------------------
O70337_BIK-02           --------------------------------------
O70337_BIK-01           --------------------------------------
Q925D2_BIK-01           --------------------------------------
G1TZR9_BIK-01           --------------------------------------
H0W025_BIK-01           --------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------
F7FUT7_BIK-01           --------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------
H2P4N6_BIK-01           --------------------------------------
G1S1X2_BIK-01           --------------------------------------
G3QCT2_BIK-01           --------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------
H2QLU7_BIK-01           --------------------------------------
Q13323_BIK-01           --------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------
A0A096NKG5_BIK-01       --------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------
F1PUF4_BIK-01           --------------------------------------
H0XAE7_BIK-01           --------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------
F6RS78_BIK-02           PGPLGLRWLAY---------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------
F6TGJ4_BMF-01           --------------------------------------
G1PAU1_BMF-01           --------------------------------------
A2AV74_BMF-02           --------------------------------------
A0A286XXB0_BMF-03       --------------------------------------
I3MDS9_BMF-02           --------------------------------------
A0A287AIU8_BMF-05       --------------------------------------
A0A287AIU8_BMF-01       --------------------------------------
A0A287AIU8_BMF-04       --------------------------------------
A0A287AIU8_BMF-03       --------------------------------------
A0A287AIU8_BMF-02       --------------------------------------
W5UEE7_BCL2L11-01       --------------------------------------
H9GL49_BMF-01           PVCFPFSEMLPRFCLEAI--------------------
K7FRX2_BMF-01           --------------------------------------
A9XRG9_BMF-02           --------------------------------------
A9XRG9_BMF-01           --------------------------------------
U3JS06_BMF-01           --------------------------------------
H0ZMX5_BMF-01           --------------------------------------
A9XRG9_BMF-03           --------------------------------------
A9XRG9_BMF-04           --------------------------------------
G1NHG8_BMF-01           --------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------
A0A337SQV0_BBC3-01      TRPVDVGDLGGRTLPPPDALASAGDFFCTM--------
Q9BXH1_BBC3-03          TRPVDVRDSGGRPLPPPDTLASAGDFLCTM--------
A0A2K5KGR6_BMF-01       --------------------------------------
A0A2K6FFR1_BMF-02       --------------------------------------
M3WRS0_BMF-02           --------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------
F7HPK0_BMF-02           --------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------
G3QIN5_BMF-02           --------------------------------------
Q96LC9_BMF-07           --------------------------------------
Q96LC9_BMF-05           --------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------
G7PAW6_BMF-01           --------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------
A0A096NTE9_BMF-03       --------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------
A2AV74_BMF-01           --------------------------------------
Q8K589_BMF-01           --------------------------------------
I3MDS9_BMF-01           --------------------------------------
G3T7Z4_BMF-01           --------------------------------------
F6X3N6_BMF-01           --------------------------------------
G3WDQ2_BMF-01           --------------------------------------
Q96LC9_BMF-06           --------------------------------------
F6TJI0_BMF-02           SAGLQLPLSELLPFSPCCGTNGENLKQPVWLL------
F6TJI0_BMF-01           LETSDLFLSCHPELPPAPGFCQDFVLS--WS-------
A0A286XXB0_BMF-02       --------------------------------------
J9PB65_BMF-01           AQQDCSCL------------------------------
A0A286XXB0_BMF-01       --------------------------------------
G1SR62_BMF-01           --------------------------------------
Q05KI3_BMF-02           --------------------------------------
Q05KI3_BMF-01           --------------------------------------
W5QFV1_BMF-01           --------------------------------------
M3WRS0_BMF-01           --------------------------------------
M3YAD5_BMF-01           --------------------------------------
A0A2U4BC98_BMF-01       --------------------------------------
A0A2K6FFR1_BMF-01       --------------------------------------
H0WYH6_BMF-01           --------------------------------------
A0A096NTE9_BMF-01       KASSFLSCQPE---------------------------
A0A2K6L933_BMF-02       LLKGRLMCL-----------------------------
A0A096NTE9_BMF-02       C-------------------------------------
A0A2K5MJY6_BMF-02       --------------------------------------
A0A2K5KGR6_BMF-02       --------------------------------------
G7PAW6_BMF-02           --------------------------------------
F7CM09_BMF-02           --------------------------------------
A0A2K6B5G4_BMF-04       --------------------------------------
A0A2K6B5G4_BMF-02       --------------------------------------
A0A2K6B5G4_BMF-01       --------------------------------------
A0A2K5Z4C3_BMF-01       --------------------------------------
A0A2K6L933_BMF-01       --------------------------------------
A0A2K6L933_BMF-03       --------------------------------------
A0A2K6RAW8_BMF-01       --------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------
F7HPK0_BMF-01           --------------------------------------
A0A2K5E1W9_BMF-01       --------------------------------------
A0A2K6TW86_BMF-02       --------------------------------------
A0A2K6TW86_BMF-01       --------------------------------------
G3QIN5_BMF-01           --------------------------------------
Q96LC9_BMF-02           --------------------------------------
Q96LC9_BMF-01           --------------------------------------
Q96LC9_BMF-04           --------------------------------------
Q96LC9_BMF-03           --------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------
A0A2J8T301_BMF-01       --------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------
E7FBJ6_BAD-01           --------------------------------------
B5XEF1_BAD-01           --------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------
I3K7B6_BAD-01           --------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------
B5X1T1_BAD-01           --------------------------------------
H3ANP3_BAD-03           --------------------------------------
H3ANP3_BAD-01           --------------------------------------
H3ANP3_BAD-02           --------------------------------------
H3ANP3_BAD-04           --------------------------------------
H3D8J8_BAD-01           --------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------
Q4V925_BAD-02           --------------------------------------
Q4V925_BAD-03           --------------------------------------
A7MCM4_BAD-01           --------------------------------------
Q4V925_BAD-04           --------------------------------------
Q4V925_BAD-01           --------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------
A0A1W4YVX7_BAD-01       --------------------------------------
A0A1W4YVX7_BAD-02       --------------------------------------
A0A3B5K831_BAD-01       --------------------------------------
A0A087X8P8_BAD-01       --------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------
G3Q8B3_BAD-01           --------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------
A0A2D0SYM2_BAD-01       --------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------
Q9BXH1_BBC3-05          --------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------
F7FFP6_BBC3-03          --------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------
G3T2N1_BBC3-01          --------------------------------------
M3Y0R3_BBC3-01          --------------------------------------
Q99ML1_BBC3-02          --------------------------------------
Q80ZG6_BBC3-01          --------------------------------------
H0XQ00_BBC3-01          --------------------------------------
J9NTK9_BBC3-01          --------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------
F1RM01_BBC3-01          --------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------
Q9BXH1_BBC3-06          --------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------
H2NZD3_BBC3-01          --------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------
B4DQK3_BBC3-01          --------------------------------------
G1SS60_BAD-01           --------------------------------------
K7E5Y2_BBC3-02          --------------------------------------
A0A337SAW2_BAD-01       --------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------
A0A2R8Z697_BAD-02       --------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------
Q92934_BAD-03           --------------------------------------
A0A2K5M0C1_BAD-02       --------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------
A0A2I3MCN5_BAD-03       --------------------------------------
A0A2K5VCD8_BAD-02       --------------------------------------
F7GVS7_BAD-02           --------------------------------------
A0A2K6E7J3_BAD-02       --------------------------------------
A0A2K5E6K7_BAD-02       --------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------
A0A2K5E6K7_BAD-03       --------------------------------------
A0A2K5HKW9_BAD-02       --------------------------------------
A0A2K6N1A1_BAD-02       --------------------------------------
A0A2K6PUM5_BAD-02       --------------------------------------
A0A2K5M0C1_BAD-03       --------------------------------------
A0A2K5VCD8_BAD-03       --------------------------------------
F7GVS7_BAD-03           --------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------
A0A2I3MCN5_BAD-02       --------------------------------------
A0A2K6E7J3_BAD-03       --------------------------------------
A0A2I2Z8C7_BAD-04       --------------------------------------
Q92934_BAD-04           --------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------
A0A2R8Z697_BAD-03       --------------------------------------
F6SJL0_BAD-02           --------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------
G1P8C5_BAD-01           --------------------------------------
W5P8G9_BAD-01           --------------------------------------
G3VRY4_BAD-02           --------------------------------------
G3VRY4_BAD-01           --------------------------------------
I3MBM5_BAD-02           --------------------------------------
I3MBM5_BAD-01           --------------------------------------
Q61337_BAD-03           --------------------------------------
Q61337_BAD-01           --------------------------------------
Q61337_BAD-02           --------------------------------------
G3TP47_BAD-01           --------------------------------------
F7DN67_BAD-01           --------------------------------------
G1MI17_BAD-01           --------------------------------------
A0A287AEF3_BAD-01       --------------------------------------
O35147_BAD-01           --------------------------------------
M3YNE7_BAD-01           --------------------------------------
F1MUT9_BAD-01           --------------------------------------
Q3SYZ0_BAD-01           --------------------------------------
H0WVR2_BAD-01           --------------------------------------
H0V608_BAD-01           --------------------------------------
A0A2K5E6K7_BAD-01       --------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------
A0A0D9R491_BAD-01       --------------------------------------
A0A2K5M0C1_BAD-01       --------------------------------------
A0A2K5VCD8_BAD-01       --------------------------------------
F7GVS7_BAD-01           --------------------------------------
A0A2K6E7J3_BAD-01       --------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------
A0A2I3MCN5_BAD-04       --------------------------------------
A0A2K6N1A1_BAD-01       --------------------------------------
A0A2K6PUM5_BAD-01       --------------------------------------
A0A2K5HKW9_BAD-01       --------------------------------------
B4DZQ9_BAD-01           --------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------
F6SJL0_BAD-01           --------------------------------------
A0A2I3MCN5_BAD-01       --------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------
Q92934_BAD-01           --------------------------------------
Q92934_BAD-02           --------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------
A0A2R8Z697_BAD-01       --------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------
F1PK10_BAD-01           --------------------------------------
Q45KI9_BAD-01           --------------------------------------
                                                              

© 1998-2019