Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

570 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          -------------VRLGEAPGKPLSPGCGSGQRGPGGAGSGGAGRGGGSR
F6RS78_BIK-01           --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
G3MWR6_HRK-01           --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       ------------MGRAGRGPGAAQSVQAPRRVPAFCPVAGGSERAAARFP
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A1S3FHA8_BCL2L11      --------------------------------------------------
Q4KMV9_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       MFPAAAAGAARARGAARGALGCRTARGGGRAASGRLCAAPGALKASPRLC
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-03       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
F7A7D2_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FHA8_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-01       --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
F7CQN5_BBC3-01          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
F6TGJ4_BMF-01           --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A0A1U8CPE0_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
I3MDS9_BMF-02           --------------------------------------------------
A0A287AIU8_BMF-05       --------------------------------------------------
A0A287AIU8_BMF-03       --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A287AIU8_BMF-04       --------------------------------------------------
A0A1S3EQA2_BMF-02       --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
A0A337SQV0_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5KGR6_BMF-01       --------------------------------------------------
A0A2K6FFR1_BMF-02       --------------------------------------------------
M3WRS0_BMF-02           --------------------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
F7HPK0_BMF-02           --------------------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
G3QIN5_BMF-02           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
G7PAW6_BMF-01           --------------------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A1S3EQA2_BMF-01       --------------------------------------------------
Q8K589_BMF-01           --------------------------------------------------
A2AV74_BMF-01           -------------------------MPGAGVFWKQYRAVCRGLLPRQLAP
I3MDS9_BMF-01           -------------------------MPRAGVFWKQYRAVRSGLLRRPPES
G3T7Z4_BMF-01           -------------------------MPRAGVFWKQYRTVLSLVHQRPPAL
F6X3N6_BMF-01           --------------------------------------------------
G3WDQ2_BMF-01           --------------------------------------------------
A0A1S3WU31_BMF-01       --------------------------------------------------
Q96LC9_BMF-06           --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
J9PB65_BMF-01           --------------------------------------------------
A0A1U8CPE0_BMF-01       --------------------------------------------------
A0A286XXB0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
F6TJI0_BMF-01           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
M3WRS0_BMF-01           --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
A0A2K6FFR1_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A2K5MJY6_BMF-02       --------------------------------------------------
A0A2K5KGR6_BMF-02       --------------------------------------------------
G7PAW6_BMF-02           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5G4_BMF-02       --------------------------------------------------
A0A2K6B5G4_BMF-01       --------------------------------------------------
A0A2K6B5G4_BMF-04       --------------------------------------------------
A0A2K5Z4C3_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-03       --------------------------------------------------
A0A2K6L933_BMF-01       --------------------------------------------------
A0A2K6RAW8_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
F7HPK0_BMF-01           --------------------------------------------------
A0A2K5E1W9_BMF-01       --------------------------------------------------
A0A2K6TW86_BMF-02       --------------------------------------------------
A0A2K6TW86_BMF-01       --------------------------------------------------
G3QIN5_BMF-01           --------------------------------------------------
Q96LC9_BMF-01           --------------------------------------------------
Q96LC9_BMF-02           --------------------------------------------------
Q96LC9_BMF-03           --------------------------------------------------
Q96LC9_BMF-04           --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
H9GL49_BMF-01           --------------------------------------------------
A9XRG9_BMF-01           --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
H0ZMX5_BMF-01           --------------------------------------------------
A9XRG9_BMF-02           --------------------------------------------------
A9XRG9_BMF-03           --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
F6Z067_BAD-01           --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
F1PUF4_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
A0A1S3FUQ7_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
G1SS60_BAD-01           --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
A0A337SAW2_BAD-01       MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGR
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z697_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0C1_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2I3MCN5_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-02       --------------------------------------------------
F7GVS7_BAD-02           --------------------------------------------------
A0A2K6E7J3_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-03       --------------------------------------------------
A0A2K5HKW9_BAD-02       --------------------------------------------------
A0A2K6N1A1_BAD-02       --------------------------------------------------
A0A2K6PUM5_BAD-02       --------------------------------------------------
A0A2K5M0C1_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-03       --------------------------------------------------
F7GVS7_BAD-03           --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2I3MCN5_BAD-02       --------------------------------------------------
A0A2K6E7J3_BAD-03       --------------------------------------------------
A0A2I2Z8C7_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z697_BAD-03       --------------------------------------------------
F6SJL0_BAD-02           --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3VRY4_BAD-01           --------------------------------------------------
G3VRY4_BAD-02           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
I3MBM5_BAD-01           --------------------------------------------------
I3MBM5_BAD-02           --------------------------------------------------
A0A091DDU4_BAD-01       --------------------------------------------------
Q61337_BAD-02           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
A0A1U7Q4V0_BAD-01       --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
O35147_BAD-01           --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A1S3FL84_BAD-01       --------------------------------------------------
A0A2K5E6K7_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5M0C1_BAD-01       --------------------------------------------------
A0A2K5VCD8_BAD-01       --------------------------------------------------
F7GVS7_BAD-01           --------------------------------------------------
A0A2K6E7J3_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2I3MCN5_BAD-04       --------------------------------------------------
A0A2K6N1A1_BAD-01       --------------------------------------------------
A0A2K6PUM5_BAD-01       --------------------------------------------------
A0A2K5HKW9_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F6SJL0_BAD-01           --------------------------------------------------
A0A2I3MCN5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z697_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          SRRRSLSSPALASPNCLGADGCRRAGAGGGSGAGRSVTSRGSRGARLQRE
F6RS78_BIK-01           --------------------------------------------------
B2KKY9_BCL2L11-01       ---------------------------------MSDTSREQTLANGPASQ
B8JK68_BCL2L11-01       ---------------------------------MSDTSREQTLANGPASQ
A0A2K6KS56_BBC3-02      ------------------------------------------LAERTWSR
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
G3MWR6_HRK-01           --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           ------------------------------------------MEEEPSPF
Q2PG01_BAD-01           ------------------------------------------MEEEPSPF
A0A2I3H4B2_BAD-01       ------------------------------------------MGEEPSPF
K7GA86_BCL2L11-01       APAGADSERRGLAEELLLEPDSLLFRQSLSASYSLDAGKGDQMAKQPSDL
G3SU55_BCL2L11-01       ------------------------------------------MAKQPSDV
G3W979_BCL2L11-01       ------------------------------------------MAKQPSDL
O43521_BCL2L11-11       ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-08       ------------------------------------------MAKQPSDV
A0A1U8BW10_BCL2L11      ------------------------------------------MAKQPSDV
O54918_BCL2L11-03       ------------------------------------------MAKQPSDV
O43521_BCL2L11-19       ------------------------------------------MAKQPSDV
O43521_BCL2L11-07       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-23       ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-07       ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
C1KGB8_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-10       ------------------------------------------MAKQPSDV
O43521_BCL2L11-20       ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-17       ------------------------------------------MAKQPSDV
O43521_BCL2L11-13       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-05       ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-09       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-09       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-06       ------------------------------------------MAKQPSDV
O43521_BCL2L11-15       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
F1SU81_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A0D9RWE0_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-05       ------------------------------------------MAKQPSDV
O43521_BCL2L11-25       ------------------------------------------MAKQPSDV
O54918_BCL2L11-08       ------------------------------------------MAKQPSDV
O54918_BCL2L11-06       ------------------------------------------MAKQPSDV
A0A1U8BW10_BCL2L11      ------------------------------------------MAKQPSDV
Q2YDF0_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A287DFJ0_BCL2L11      ------------------------------------------MAKQPSDV
O54918_BCL2L11-05       ------------------------------------------MAKQPSDV
O88498_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
H2P5E2_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
A0A286XJN2_BCL2L11      ------------------------------------------MAKQPSDV
A0A1S3FHA8_BCL2L11      ------------------------------------------MAKQPSDV
Q4KMV9_BCL2L11-01       ------------------------------------------MAKQPSVL
F7FTC8_BCL2L11-01       ------------------------------------------MAKQPSDL
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
M3YDI3_BCL2L11-01       LPRFFRAEGQGAPGRRRTRAGRRGARARTRRSEGKGRTKKDQMAKQPSDV
F6XMC1_BCL2L11-02       ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-01       ------------------------------------------MAKQPSDV
F7CXT2_BCL2L11-01       ------------------------------------------MAKQPSDL
F6XMC1_BCL2L11-08       ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-08       ------------------------------------------MAKQPSDV
O43521_BCL2L11-22       ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-06       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-04       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-21       ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-24       ------------------------------------------MAKQPSDV
O43521_BCL2L11-12       ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-06       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
O54918_BCL2L11-01       ------------------------------------------MAKQPSDV
O88498_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A1U8BW10_BCL2L11      ------------------------------------------MAKQPSDV
A0A287DFJ0_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-07       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-05       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-16       ------------------------------------------MAKQPSDV
O43521_BCL2L11-09       ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-04       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-18       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
F1SU81_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
W5PY58_BCL2L11-01       ------------------------------------------MAKQPSDV
F7A7D2_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A286XJN2_BCL2L11      ------------------------------------------MAKQPSDV
A0A286XJN2_BCL2L11      ------------------------------------------MAKQPSDV
G1SSY0_BCL2L11-01       ------------------------------------------MAKQPSDV
H0XW23_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A1S3FHA8_BCL2L11      ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
G1LDR8_BCL2L11-01       ------------------------------------------MAKQPSDV
J9NWV6_BCL2L11-01       ------------------------------------------MAKQPSDV
F1SU81_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
Q6P7C5_BAD-01           -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
A0A287AEF3_BAD-02       --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          -------------------------------------------MARAQQD
F7CQN5_BBC3-01          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          -------------------------------------------MARARQE
M3Y0R3_BBC3-01          -------------------------------------QAPGSAMARARQE
A0A1U7R5N5_BBC3-01      -------------------------------------------MARARQE
Q99ML1_BBC3-02          -------------------------------------------MARARQE
Q80ZG6_BBC3-01          -------------------------------------------MARARQE
H0XQ00_BBC3-01          -------------------------------------------MARARQE
J9NTK9_BBC3-01          -------------------------------------------MARARQE
A0A337SQV0_BBC3-02      -------------------------------------------MARARQE
F1RM01_BBC3-01          -------------------------------------------MARARQE
A0A2K6FQZ3_BBC3-01      -------------------------------------------MARARQE
Q9BXH1_BBC3-06          -------------------------------------------MARARQE
A0A2I3RIG5_BBC3-02      -------------------------------------------MARARQE
H2NZD3_BBC3-01          -------------------------------------------MARARQE
A0A2K6QZU4_BBC3-01      -------------------------------------------MARARQE
A0A0D9S2H2_BBC3-01      -------------------------------------QAPGSAMARARQE
B4DQK3_BBC3-01          -------------------------------------MAPGSAMARARQE
F6TGJ4_BMF-01           --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A0A1U8CPE0_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
I3MDS9_BMF-02           --------------------------------------------------
A0A287AIU8_BMF-05       --------------------------------------------------
A0A287AIU8_BMF-03       --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A287AIU8_BMF-04       --------------------------------------------------
A0A1S3EQA2_BMF-02       --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
A0A337SQV0_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5KGR6_BMF-01       --------------------------------------------------
A0A2K6FFR1_BMF-02       --------------------------------------------------
M3WRS0_BMF-02           --------------------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
F7HPK0_BMF-02           --------------------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
G3QIN5_BMF-02           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
G7PAW6_BMF-01           --------------------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A1S3EQA2_BMF-01       --------------------------------------------------
Q8K589_BMF-01           --------------------------------------------------
A2AV74_BMF-01           AAVAAAARATASHRSPLEFAPFFPIECGHQAPRVFFTLDPGAEPWHHNSE
I3MDS9_BMF-01           AAAAGPASGSRLP------------GSGVSLPQVFITLDPGAEPWHHDSE
G3T7Z4_BMF-01           AAAA--VRSPRLPPLPAELFPSFPIESGRQAPRVLVTLDPGAEPWRHDPE
F6X3N6_BMF-01           --------------------------------------------------
G3WDQ2_BMF-01           --------------------------------------------------
A0A1S3WU31_BMF-01       --------------------------------------------------
Q96LC9_BMF-06           --------------------------------------------------
A0A286XXB0_BMF-02       ---------MPGAGVFWKQYRARRRRRGPDPPRVFVTLDPGTEPWHHDSE
J9PB65_BMF-01           --------------------------------------------------
A0A1U8CPE0_BMF-01       --------------------------------------------------
A0A286XXB0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
F6TJI0_BMF-01           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
M3WRS0_BMF-01           --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
A0A2K6FFR1_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A2K5MJY6_BMF-02       --------------------------------------------------
A0A2K5KGR6_BMF-02       --------------------------------------------------
G7PAW6_BMF-02           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5G4_BMF-02       --------------------------------------------------
A0A2K6B5G4_BMF-01       --------------------------------------------------
A0A2K6B5G4_BMF-04       --------------------------------------------------
A0A2K5Z4C3_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-03       --------------------------------------------------
A0A2K6L933_BMF-01       --------------------------------------------------
A0A2K6RAW8_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
F7HPK0_BMF-01           --------------------------------------------------
A0A2K5E1W9_BMF-01       --------------------------------------------------
A0A2K6TW86_BMF-02       --------------------------------------------------
A0A2K6TW86_BMF-01       --------------------------------------------------
G3QIN5_BMF-01           --------------------------------------------------
Q96LC9_BMF-01           --------------------------------------------------
Q96LC9_BMF-02           --------------------------------------------------
Q96LC9_BMF-03           --------------------------------------------------
Q96LC9_BMF-04           --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
H9GL49_BMF-01           --------------------------------------------------
A9XRG9_BMF-01           --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
H0ZMX5_BMF-01           --------------------------------------------------
A9XRG9_BMF-02           --------------------------------------------------
A9XRG9_BMF-03           --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A2K5JY52_PMAIP1-      -----------------------------MPGKKA---------------
A0A096MPU8_PMAIP1-      -----------------------------MPGKKA---------------
A0A2K5ZWH1_PMAIP1-      -----------------------------MPGKKA---------------
A0A2K5VPX2_PMAIP1-      -----------------------------MPGKKA---------------
A0A2K6BV75_PMAIP1-      -----------------------------MPGKKA---------------
A0A2K6KJF2_PMAIP1-      -----------------------------MPGKKA---------------
A0A2K6NC45_PMAIP1-      -----------------------------MPGKKA---------------
Q13794_PMAIP1-02        -----------------------------MPGKKA---------------
A0A2R9AKC9_PMAIP1-      -----------------------------MPGKKA---------------
A0A1D5QGJ8_PMAIP1-      -----------------------------MPGKKA---------------
A0A2I2YVQ5_PMAIP1-      -----------------------------MPGKKA---------------
A0A2I3SX38_PMAIP1-      -----------------------------MPGKKA---------------
C1C3S9_BAD-01           -----------------------------------MGDSPHKSMFSIEEF
F6Z067_BAD-01           -----------------------------MADSSPSAVFKLEEFDNEEQG
M3XHJ5_BCL2L11-01       --------------------------------------MPTEESLQFDKD
W5QCU2_BIK-01           -----------------------------MYQARPLSRNLFLYTFLQNHG
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           -----------------------------MSEARLMARDV-IKTVPHDQV
O70337_BIK-01           -----------------------------MSEARLMARDV-IKTVPHDQV
Q925D2_BIK-01           -----------------------------MSEARLMARDI-IKTLLHDQV
G1TZR9_BIK-01           -----------------------------MSEVRPGSRDLFQEALLDEQV
F1PUF4_BIK-01           -----------------------------MSHSGPLSRNLFLSTFLQEH-
H0XAE7_BIK-01           -----------------------------MSAGRPVSMDHFMETFPFEQL
A0A2K6FM79_BIK-01       -----------------------------MSEVRPVSTDLLMETFPFEHL
A0A1S3FUQ7_BIK-01       -----------------------------MSEAGSVTRDLFIKTLLYQQM
H0W025_BIK-01           -----------------------------MSEAKPVARDPLMETPLFEPP
A0A2K5CLG5_BIK-01       -----------------------------MSEVRPLSSDILMETLLCEQF
F7FUT7_BIK-01           -----------------------------MSEVRPLSSDIFMETLLCEQF
A0A2K6TBD7_BIK-01       -----------------------------MSEDRPLSSDILMETLLCEQF
H2P4N6_BIK-01           -----------------------------MSEVRPISRDILMETLLYEQL
G1S1X2_BIK-01           -----------------------------MSEVRPISRDILMESLLYEQL
G3QCT2_BIK-01           -----------------------------MSEVRPLSRDILMETLLYEQL
A0A2R8ZXD2_BIK-01       -----------------------------MSEVRPLSRDILMETLLYEQL
H2QLU7_BIK-01           -----------------------------MSEVRPLSRDILMETLLYEQL
Q13323_BIK-01           -----------------------------MSEVRPLSRDILMETLLYEQL
A0A2K6MCW0_BIK-01       -----------------------------MSGVRPVSRDILMETLLYEQL
A0A2K6QK74_BIK-01       -----------------------------MSGVRPVSRDILMETLLYEQL
A0A0D9QZY8_BIK-01       -----------------------------MSGVRPISRHILMESLLYEQL
A0A2K5VW94_BIK-01       -----------------------------MSGVRPISRDTLMETLLYEQL
A0A2K6DBJ4_BIK-01       -----------------------------MSGVRPISRDTLMETLLYEQL
A0A2K5J4Q7_BIK-01       -----------------------------MSGVRPISRDILMETLLYEQL
A0A096NKG5_BIK-01       -----------------------------MSGVRPISRDILMETLLYEQL
A0A2K5LDM6_BIK-01       -----------------------------MSGVRPISRDTWMETLLYEQL
A0A2K5XSA1_BIK-01       -----------------------------MSGVRPISRDTLMETLLYEQL
I3K7B6_BAD-01           --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
G1SS60_BAD-01           --------------------------------------------------
Q9GL49_PMAIP1-01        ------------------------------------------MRSSGSLG
H3D8J8_BAD-01           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
A0A337SAW2_BAD-01       KRPRPLASPGDISKADWAGSVTVPVAQATRAGLPQYWREAAGPGQGPRDR
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z697_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0C1_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2I3MCN5_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-02       --------------------------------------------------
F7GVS7_BAD-02           --------------------------------------------------
A0A2K6E7J3_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-03       --------------------------------------------------
A0A2K5HKW9_BAD-02       --------------------------------------------------
A0A2K6N1A1_BAD-02       --------------------------------------------------
A0A2K6PUM5_BAD-02       --------------------------------------------------
A0A2K5M0C1_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-03       --------------------------------------------------
F7GVS7_BAD-03           --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2I3MCN5_BAD-02       --------------------------------------------------
A0A2K6E7J3_BAD-03       --------------------------------------------------
A0A2I2Z8C7_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z697_BAD-03       --------------------------------------------------
F6SJL0_BAD-02           --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------QGPRYR
G3VRY4_BAD-01           --------------------------------------------------
G3VRY4_BAD-02           --------------------------------------------------
G3TP47_BAD-01           ----------------GPPENPSPASTHAQGVRMSGAEHPEKKKGRRRSS
I3MBM5_BAD-01           ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
I3MBM5_BAD-02           ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
A0A091DDU4_BAD-01       --------------------------------------------------
Q61337_BAD-02           -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
Q61337_BAD-03           --------------------------------------------------
A0A1U7Q4V0_BAD-01       -------------MGTPKQPSLAPAHALGVRKSDPGIRSLGNDAGGRRRR
Q61337_BAD-01           -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
G1MI17_BAD-01           -------------VGTPENPSSAPTHGPGKRKSGTDRRETRKGPRTTALA
A0A287AEF3_BAD-01       -----------MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSG
O35147_BAD-01           -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
M3YNE7_BAD-01           --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A1S3FL84_BAD-01       --------------------------------------------------
A0A2K5E6K7_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5M0C1_BAD-01       --------------------------------------------------
A0A2K5VCD8_BAD-01       --------------------------------------------------
F7GVS7_BAD-01           --------------------------------------------------
A0A2K6E7J3_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2I3MCN5_BAD-04       --------------------------------------------------
A0A2K6N1A1_BAD-01       --------------------------------------------------
A0A2K6PUM5_BAD-01       --------------------------------------------------
A0A2K5HKW9_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F6SJL0_BAD-01           --------------------------------------------------
A0A2I3MCN5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z697_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
F1PK10_BAD-01           ---------------TPENPSSAPAQDPGTRKSGTERREKSCALTTCCLA
Q45KI9_BAD-01           --------------------------------------------------
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A0P0HZF9_PMAIP1-      ----------------------------------------MAKK------
Q0GKC8_PMAIP1-01        ----------------------------------------MAKK------
A0A2I3HX97_PMAIP1-      -----------------------KPGR-ARRNAQPSPAPAPAEL------
A0A1D5PAR2_PMAIP1-      ----------------------MMPGRTIRK---PAPPAAPAER------
A0A2K6EM90_PMAIP1-      -----------------------MPVKKARKNAQPSPTRTRAEI------
G1P8F9_PMAIP1-01        -----------------------MPGKKARKNAQPSPTRAPAEA------
G3T0P7_PMAIP1-01        -----------------------MPGKKARKSAQPGPAGTPAGT------
Q1PCT2_PMAIP1-01        -----------------------MPGRKARKSAQPGPTRAPEEL------
G1LIZ7_PMAIP1-01        -----------------------MPGKKARKSAQASPARTRGQP------
A0A2K5NJZ2_PMAIP1-      -----------------------MPGKKARKNAQPSPMRAQAEL------
A0A0D9S003_PMAIP1-      -----------------------MPGKKARKNAQPSPTRAQAEL------
A0A2K5VPX2_PMAIP1-      -----------------------MPGKKARKNAQPSPTRAQAEL------
A0A2K6BV75_PMAIP1-      -----------------------MPGKKARKNAQPSPTRAQAEL------
A0A2K5ZWH1_PMAIP1-      -----------------------MPGKKARKNAQPSPTRAQAEL------
A0A096MPU8_PMAIP1-      -----------------------MPGKKARKNAQPSPTRAQAEL------
A0A2K5JY52_PMAIP1-      -----------------------MPGKKARKNAQPSPARAQAEL------
A0A2K6KJF2_PMAIP1-      -----------------------MPGKKARKNAQPSPARAQAEL------
A0A2K6NC45_PMAIP1-      -----------------------MPGKKARKNAQPSPARAQAEL------
A0A2K6S6C4_PMAIP1-      -----------------------MPGKKARKSAQPSPARAPADL------
A0A2I2YVQ5_PMAIP1-      -----------------------MPGKKARKNAQPSPARAPAEL------
Q13794_PMAIP1-01        -----------------------MPGKKARKNAQPSPARAPAEL------
A0A2R9AKC9_PMAIP1-      -----------------------MPGKKARKNAQPSPARAPAEL------
A0A2I3SX38_PMAIP1-      -----------------------MPGKKARKNAQPSPARAPAEL------
H2NWG2_PMAIP1-01        -----------------------MPGKKARKNAQPSPARAPAEL------
A0A2K5CFK7_PMAIP1-      -----------------------MPGKKARKSAQPSPSRAPADL------
F7GW45_PMAIP1-01        -----------------------MPGKKARKSAQPSPARAPADL------
A0A337SUX1_PMAIP1-      -----------------------MPGKRTRKSAQPSPARAPAEP------
W5P738_PMAIP1-01        -----------------------MPGRRARRSAQPSPTRVPADP------
A0A287AZR7_PMAIP1-      -------LSKETFMAKGKVLFASMPHRSSNKNTQTNPLRLALPP------
G1MV54_BCL2L11-01       --------------------------FLLCAASRWRSHSLAEEI------
G1PDJ5_BCL2L11-01       --------------------------------SMQQSQALPVDM------
K7E5Y2_BBC3-01          AAAAAAAAEPAWEPAAQ-----------DTCVRPAGATAGAGAGAVASGG
F6RS78_BIK-01           --------MSQVGPVSR---------------------------------
B2KKY9_BCL2L11-01       GSGEST-GGGVVLPAGH-----------FDFPQPGEGDPLR---------
B8JK68_BCL2L11-01       GSGEST-GGGVVLPAGH-----------FDFPQPGEGDPLR---------
A0A2K6KS56_BBC3-02      GASPGALAAPGVAGRRR--------------SGPGIGAQLRRMA-RRLN-
F7G1G0_HRK-01           --MCPC-------PLHRGRG--------PPAVCACSSDRLE---------
A0A1U7R468_HRK-01       --MCPC-------PRHRGHG--------PPAVCGCGDTRPG---------
P62816_HRK-03           --MCPC-------PRHRGRG--------PPAVCGCGDARPG---------
P62817_HRK-01           --MCPC-------PRHRGRG--------PPAVCGCGDARPG---------
A0A287A5N9_HRK-01       --MCPC-------PLHRGRG--------PPAVCACSASRLG---------
H2NIS8_HRK-01           --MCPC-------PLHRDRG--------PPAVCACSAGRLG---------
A0A2K5KZ69_HRK-01       --MCPC-------PLHRGRG--------PPAVCDCSAGRLG---------
H2Q6Y8_HRK-01           --MCPC-------PLHRGRD--------PPAVCACSAGRLG---------
G3UH24_HRK-01           --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
A0A2K5BYA0_HRK-01       --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
G3MWR6_HRK-01           --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
U3E722_HRK-01           --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
A0A0D9SC73_HRK-01       --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
A0A337SQ56_HRK-01       --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
G3QTJ6_HRK-01           --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
O00198_HRK-01           --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
A0A1D5R1E4_HRK-01       --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
A0A2K6AYL7_HRK-01       --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
G1QHD8_HRK-01           --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
G1T7W1_HRK-01           --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
H0Y001_HRK-01           --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
A0A096N944_HRK-01       --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
A0A2K6GL98_HRK-01       --MCPC-------PLHRGRG--------PPAVCACSAGRLG---------
E2RLD4_HRK-01           --MCPC-------PLHRGRG--------PPAVCACSAGRLA---------
F7GVS7_BAD-04           RGRSRS-APPNLWAAQR--Y--------GRELRRMSDEFVDS--------
Q2PG01_BAD-01           RGRSRS-APPNLWAAQR--Y--------GRELRRMSDEFVDS--------
A0A2I3H4B2_BAD-01       RGRSRS-APPNLWAAQR--Y--------GRELRRMSDEFVDS--------
K7GA86_BCL2L11-01       NSECDG-EGGQFQSIERPSQ--------PQHLRPGAPTSIQTQY-Q----
G3SU55_BCL2L11-01       SSECDR-EGGQLQPAERPPQ--------PPQLRPGAPTSLLTEP-QGNPD
G3W979_BCL2L11-01       NSECDR-EGGQLQPTERPTQ---------PQLRPGAPTSIQTQY-QGN-S
O43521_BCL2L11-11       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
F7HHA9_BCL2L11-08       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A1U8BW10_BCL2L11      SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEQ-Q----
O54918_BCL2L11-03       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O43521_BCL2L11-19       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O43521_BCL2L11-07       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O43521_BCL2L11-23       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
F7HHA9_BCL2L11-07       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
C1KGB8_BCL2L11-01       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTER-Q----
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER-----------PPQLRPGAPTSLQTEP-Q----
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEQ-Q----
O43521_BCL2L11-10       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O43521_BCL2L11-20       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O43521_BCL2L11-17       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O43521_BCL2L11-13       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
F7HHA9_BCL2L11-05       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
F6XMC1_BCL2L11-09       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
F7HHA9_BCL2L11-09       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O43521_BCL2L11-06       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O43521_BCL2L11-15       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
F1SU81_BCL2L11-03       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTER-Q----
A0A0D9RWE0_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O43521_BCL2L11-05       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O43521_BCL2L11-25       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O54918_BCL2L11-08       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O54918_BCL2L11-06       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A1U8BW10_BCL2L11      SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEQ-Q----
Q2YDF0_BCL2L11-01       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTER-Q----
A0A287DFJ0_BCL2L11      SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O54918_BCL2L11-05       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O88498_BCL2L11-02       NSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTES-Q----
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
O43521_BCL2L11-02       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
H2P5E2_BCL2L11-01       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEQ-Q----
A0A286XJN2_BCL2L11      SCECDR-EGGQLQPAER-----------PSQLRAGAPTSLQTEP-Q----
A0A1S3FHA8_BCL2L11      SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEQ-Q----
Q4KMV9_BCL2L11-01       SPDCNSGEGGQLQSTSRQHS--------HRPLRRGAPTSLSSPF-QGN--
F7FTC8_BCL2L11-01       NSECDS-EGGRLEPAEGPAQ--------PPQLRPGAPTSIRTQY-Q----
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTD-------
M3YDI3_BCL2L11-01       SSECDR-EGGQLQPVER-----------PPQLRPGAPTSLQTEQ-Q----
F6XMC1_BCL2L11-02       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-Q----
F6XMC1_BCL2L11-01       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
F7CXT2_BCL2L11-01       NSECDR-EGGQLQPTERPTQ--------PQQLRPGAPTSIQTQY-QGN--
F6XMC1_BCL2L11-08       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEQ-QGNPE
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEQ-QGNPE
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
O43521_BCL2L11-08       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
O43521_BCL2L11-22       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
F7HHA9_BCL2L11-03       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
F6XMC1_BCL2L11-06       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
F6XMC1_BCL2L11-04       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
O43521_BCL2L11-21       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
F7HHA9_BCL2L11-01       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
O43521_BCL2L11-24       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
O43521_BCL2L11-12       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
F7HHA9_BCL2L11-06       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
O54918_BCL2L11-01       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPD
O88498_BCL2L11-01       NSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTES-QGNPD
A0A1U8BW10_BCL2L11      SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEQ-QGNPD
A0A287DFJ0_BCL2L11      SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
F6XMC1_BCL2L11-07       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
F6XMC1_BCL2L11-05       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
F7HHA9_BCL2L11-02       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
O43521_BCL2L11-16       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
O43521_BCL2L11-09       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
F7HHA9_BCL2L11-04       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
O43521_BCL2L11-18       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
F6XMC1_BCL2L11-03       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
O43521_BCL2L11-03       SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER-----------PPQLRPGAPTSLQTEP-QGNPE
F1SU81_BCL2L11-02       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTER-QGN--
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEQ-QGN--
W5PY58_BCL2L11-01       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTER-QGN--
F7A7D2_BCL2L11-01       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQIEQ-QGN--
A0A286XJN2_BCL2L11      SCECDR-EGGQLQPAER-----------PSQLRAGAPTSLQTEP-QGN--
A0A286XJN2_BCL2L11      SCECDR-EGGQLQPAER-----------PSQLRAGAPTSLQTEP-QGN--
G1SSY0_BCL2L11-01       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQSEP-QGN--
H0XW23_BCL2L11-01       GSECDR-EGGQLQPAER-----------PPQLRPGAPTSLHTEP-QGNPE
A0A1S3FHA8_BCL2L11      SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEQ-QGNPE
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEQ-QGN--
G1LDR8_BCL2L11-01       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEQ-QGN--
J9NWV6_BCL2L11-01       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTEQ-QGN--
F1SU81_BCL2L11-01       SSECDR-EGGQLQPAER-----------PPQLRPGAPTSLQTER-QGN--
A0A286XF37_PMAIP1-      -----------------------------------MPGKVCKSAQP-NST
A0A1U7QLK6_PMAIP1-      -----------------------------------MLQSVARQNAPSNPA
Q9JM54_PMAIP1-01        -----------------------------------MPGRKARRNAPVNPT
Q5U777_PMAIP1-01        -----------------------------------MPGRKARRNAPLNPT
I3LVX0_BIK-01           ---------------------------------------MVQGSHQVALR
A9XRH0_BMF-01           -----------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGNA------
R4G9R5_BCL2L11-01       --------------------------------------------------
Q6P7C5_BAD-01           PAAQSMFQIPEFEPSEQEDA--------STTDRGLGPSLTEDQP-GPYLA
A0A287AEF3_BAD-02       -----MFQIPEFEQSEQEDS--------SPADRGLGPSPTGTDP-QAPAS
O61667_EGL1-01          --------------------------------------------------
A3KND0_BMF-01           ---------------------------MDELDDDVFYPDAFGYPDQTITS
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      -------------------------------------------------Y
F1SMU1_PMAIP1-01        ----------------------------------------ARAAAGAPTS
Q9BXH1_BBC3-04          --------------------------------MKFGMGSAQACP----CQ
K7E5Y2_BBC3-02          GSSPEPVEGLPRESPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGP
F7CQN5_BBC3-01          ------------------------------------AGQSSRPRGPAPR-
A0A2I3HWI8_BBC3-03      --------------------------------MKFGMGSARACPCQVPRA
A0A2K6FQZ3_BBC3-04      --------------------------------MKFGAGSARACPCQVPGT
Q9BXH1_BBC3-05          --------------------------------MKFGMGSAQACPCQVPRA
A0A2R9BZA9_BBC3-01      --------------------------------MKFGMGSAQACPCQVPRA
A0A2I3RGH5_BBC3-03      --------------------------------MKFGMGSAQACPCQVPRA
A0A2K5P2T8_BBC3-03      --------------------------------IKFGVGSARACPCQVPRA
A0A2K5V8J3_BBC3-03      --------------------------------IKFGVGSARACPCQVPRA
F7FFP6_BBC3-03          --------------------------------IKFGVGSARACPCQVPRA
A0A2K6ASP2_BBC3-03      --------------------------------IKFGVGSARACPCQVPRA
A0A2I3N2Z9_BBC3-03      --------------------------------IKFGVGSARACPCQVPRA
A0A2K6QZU4_BBC3-04      --------------------------------IKFGVGSARACPCQVPRA
A0A2R8MW85_BBC3-03      --------------------------------MKCGVGSAWACPCQVPRA
A0A2K6STD6_BBC3-02      --------------------------------MKCGMGSAWACPCQVPRA
G3T2N1_BBC3-01          GSSPEPVEGLARESPRPFPLGSLVPSAVSCGLCEPGLPRV-AGPRLLPGP
M3Y0R3_BBC3-01          GSSPEPVEGLSRDGPRPFPLSRLVPSAVSCGLWESDCSPRVAAHGLFRAG
A0A1U7R5N5_BBC3-01      GSSPEPVEGLARDSPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLP--
Q99ML1_BBC3-02          GSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLP--
Q80ZG6_BBC3-01          GSSPEPVEGLARDSPRPFPLGRLMPSAVSCGLCEPGLPAAPAAPALLP--
H0XQ00_BBC3-01          GSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLP--
J9NTK9_BBC3-01          GSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLP--
A0A337SQV0_BBC3-02      GSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLP--
F1RM01_BBC3-01          GSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLP--
A0A2K6FQZ3_BBC3-01      GSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLP--
Q9BXH1_BBC3-06          GSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLP--
A0A2I3RIG5_BBC3-02      GSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLP--
H2NZD3_BBC3-01          GSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPALLP--
A0A2K6QZU4_BBC3-01      GSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAATPAAPALLP--
A0A0D9S2H2_BBC3-01      GSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPALLP--
B4DQK3_BBC3-01          GSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLP--
F6TGJ4_BMF-01           -----------QESYLNMDE-------LDDDVFYPD--EFGYPD-QTMTS
G1PAU1_BMF-01           -----------MEPPQCVEE-------LEDDVFQPED-ELGTQP-GSLPS
A0A1U8CPE0_BMF-02       ------IFPGEMEPPQCVEE-------LEDDVFQSEDGEPGTQP-GSLLS
A0A286XXB0_BMF-03       ------VFPREMEPPQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
I3MDS9_BMF-02           ------VFPEEMEPPQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
A0A287AIU8_BMF-05       -----------MEPPQCVEE-------LEDDVFQPEEGEPGTQP-RR-VS
A0A287AIU8_BMF-03       -----------MEPPQCVEE-------LEDDVFQPEEGEPGTQP-RR-VS
A0A287AIU8_BMF-01       -----------MEPPQCVEE-------LEDDVFQPEEGEPGTQP-RR-VS
A0A287AIU8_BMF-02       -----------MEPPQCVEE-------LEDDVFQPEEGEPGTQP-RR-VS
A0A287AIU8_BMF-04       -----------MEPPQCVEE-------LEDDVFQPEEGEPGTQP-RR-VS
A0A1S3EQA2_BMF-02       ------IVPGEMEPPQCVEE-------LEDDVFQAEDGEPGTQP-GSLLS
A2AV74_BMF-02           ------MSPGEMEPPQCVEE-------LEDDVFQSEDGEPGTQP-GGLLS
A0A337SQV0_BBC3-01      ----------------------------------------------VYLS
Q9BXH1_BBC3-03          ----------------------------------------------MKFG
A0A2K5KGR6_BMF-01       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A2K6FFR1_BMF-02       -----------MEPSHCVEE-------LEDDVFQPEDGESGTQP-GSVLS
M3WRS0_BMF-02           -----------MEPPQCVEE-------LEDDVFQPEDVEPGTQP-GSLLS
A0A2K5E1W9_BMF-02       -----------MEPSQCVEE-------LEDDVFQSEDGEPGTQP-GSLLS
F7HPK0_BMF-02           -----------MEPSQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
A0A2K6TW86_BMF-03       -----------MEPSQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
A0A2K6RAW8_BMF-02       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
G3QIN5_BMF-02           -----------MEPSQCVEE-------LEDDVFQPEDGEPVTQP-GSLLS
Q96LC9_BMF-07           -----------MEPSQCVEE-------LEDDVFQPEDGEPVTQP-GSLLS
Q96LC9_BMF-05           -----------MEPSQCVEE-------LEDDVFQPEDGEPVTQP-GSLLS
A0A2R9BS98_BMF-02       -----------MEPSQCVEE-------LEDDVFQPEDGEPVTQP-GSLLS
A0A2J8QDD5_BMF-01       -----------MEPSQCVEE-------LEDDVFQPEDGEPVTQP-GSLLS
A0A2K5MJY6_BMF-01       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
G7PAW6_BMF-01           -----------MEPSRCVEE-------LEDDVFQPEDGEPGSQP-GSSLS
A0A2K6B5G4_BMF-03       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A2K5Z4C3_BMF-02       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A096NTE9_BMF-03       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A2I3HD83_BMF-01       -----------MEPSQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
A0A1S3EQA2_BMF-01       -----------MEPPQCVEE-------LEDDVFQAEDGEPGTQP-GSLLS
Q8K589_BMF-01           -----------MEPPQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
A2AV74_BMF-01           AETLSWSHPGEMEPPQCVEE-------LEDDVFQSEDGEPGTQP-GGLLS
I3MDS9_BMF-01           AETLSWSHPGEMEPPQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
G3T7Z4_BMF-01           TDTLSWSHPGEMEPSQCVEE-------LEDDVFQPEEGEPGTQP-GGLLS
F6X3N6_BMF-01           -----------MEPPHYVEE-------LEDDVFHPEDSEPGAQP-GGLTS
G3WDQ2_BMF-01           -----------MESPHYVEE-------LEDDVFHPEDSEPGAQP-GGLTS
A0A1S3WU31_BMF-01       -----------MELPQCVDE-------LEDDVFQPEDGEPGTTP-GSLLS
Q96LC9_BMF-06           -----------MEPSQCVEE-------LEDDVFQPEDGEPVTQP-GSLLS
A0A286XXB0_BMF-02       ADSLSWSHPGEMEPPQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
J9PB65_BMF-01           -----------MEPPQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
A0A1U8CPE0_BMF-01       -----------MEPPQCVEE-------LEDDVFQSEDGEPGTQP-GSLLS
A0A286XXB0_BMF-01       -----------MEPPQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
G1SR62_BMF-01           -----------MEPPQCVEE-------LEDDVFQPEDGEPGTQP-QSLLS
F6TJI0_BMF-01           -------LTGDMEPPQCVEE-------LEDDVFQPEDGEPGTQP-RSLLS
Q05KI3_BMF-01           -----------MEPPQCVEE-------LEDDVFQPEDGEPGTQP-RSLLS
W5QFV1_BMF-01           -------LTGEMEPPQCVEE-------LEDDVFQPEDGEPGAQP-RRLLS
M3WRS0_BMF-01           -----------MEPPQCVEE-------LEDDVFQPEDVEPGTQP-GSLLS
M3YAD5_BMF-01           -----------MEPPQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
A0A2K6FFR1_BMF-01       -----------MEPSHCVEE-------LEDDVFQPEDGESGTQP-GSVLS
H0WYH6_BMF-01           -----------MEPSQCVEE-------LEDDVFQPEDGELGT---GNVLS
A0A096NTE9_BMF-01       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A2K6L933_BMF-02       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A096NTE9_BMF-02       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A2K5MJY6_BMF-02       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A2K5KGR6_BMF-02       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
G7PAW6_BMF-02           -----------MEPSRCVEE-------LEDDVFQPEDGEPGSQP-GSSLS
F7CM09_BMF-02           -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A2K6B5G4_BMF-02       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A2K6B5G4_BMF-01       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A2K6B5G4_BMF-04       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A2K5Z4C3_BMF-01       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A2K6L933_BMF-03       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A2K6L933_BMF-01       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A2K6RAW8_BMF-01       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
A0A0D9R4R5_BMF-01       -----------MEPSRCVEE-------LEDDVFQPEDGEPGAQP-GSSLS
F7HPK0_BMF-01           -----------MEPSQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
A0A2K5E1W9_BMF-01       -----------MEPSQCVEE-------LEDDVFQSEDGEPGTQP-GSLLS
A0A2K6TW86_BMF-02       -----------MEPSQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
A0A2K6TW86_BMF-01       -----------MEPSQCVEE-------LEDDVFQPEDGEPGTQP-GSLLS
G3QIN5_BMF-01           -----------MEPSQCVEE-------LEDDVFQPEDGEPVTQP-GSLLS
Q96LC9_BMF-01           -----------MEPSQCVEE-------LEDDVFQPEDGEPVTQP-GSLLS
Q96LC9_BMF-02           -----------MEPSQCVEE-------LEDDVFQPEDGEPVTQP-GSLLS
Q96LC9_BMF-03           -----------MEPSQCVEE-------LEDDVFQPEDGEPVTQP-GSLLS
Q96LC9_BMF-04           -----------MEPSQCVEE-------LEDDVFQPEDGEPVTQP-GSLLS
A0A2R9BS98_BMF-01       -----------MEPSQCVEE-------LEDDVFQPEDGEPVTQP-GSLLS
A0A2J8QDD5_BMF-02       -----------MEPSQCVEE-------LEDDVFQPEDGEPVTQP-GSLLS
A0A2J8T301_BMF-01       -----------MEPSQCVEE-------LEDDVFQPEDGEPGTQS-GSLLS
H9GL49_BMF-01           -----------MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQP-SEMTF
A9XRG9_BMF-01           -----------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQP-GEMTA
K7FRX2_BMF-01           -----------MDPPSYLEEDYSSLDGLDDDVFHSDDFGLTGQP-GEMTP
U3JS06_BMF-01           -----------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQP-GEMTA
H0ZMX5_BMF-01           -----------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQP-GEMTA
A9XRG9_BMF-02           -----------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQP-GEMTA
A9XRG9_BMF-03           -----------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQP-GEMTA
G1NHG8_BMF-01           -----------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQP-GEMTA
W5N4P7_BMF-01           -----------------MEE-------DEDDVFHPSH-------------
I3K2D6_BMF-01           -----------------MDD-------EEDDVFEPK--------------
A0A096LRV0_BMF-01       -----------------MED-------EEDDVFEPD--------------
A0A2U9CJH3_BMF-01       -----------------MDD-------EEDDVFEPD--------------
Q0GKC7_BMF-01           -----------MDEDEDDVF--------RKGLQHWPPPHLQIKQTELAGR
A0A2K5JY52_PMAIP1-      -----------------RKN--------AQPSPARAQ-AGT-DPLGPAKT
A0A096MPU8_PMAIP1-      -----------------RKN--------AQPSPTRAQ-AGQAGTAGTARD
A0A2K5ZWH1_PMAIP1-      -----------------RKN--------AQPSPTRAQ-AGQAGTAGTARD
A0A2K5VPX2_PMAIP1-      -----------------RKN--------AQPSPTRAQ-AGQAGTAGTARD
A0A2K6BV75_PMAIP1-      -----------------RKN--------AQPSPTRAQ-AGPAGTAGTARD
A0A2K6KJF2_PMAIP1-      -----------------RKN--------AQPSPARAQ-AGPAGTAGTARD
A0A2K6NC45_PMAIP1-      -----------------RKN--------AQPSPARAQ-AGPAGTAGTARD
Q13794_PMAIP1-02        -----------------RKN--------AQPSPARAP-AGPAGTAGTARD
A0A2R9AKC9_PMAIP1-      -----------------RKN--------AQPSPARAP-AGP---AGTARD
A0A1D5QGJ8_PMAIP1-      -----------------RKN--------AQPSPTRAQAAGTAGTAGTARD
A0A2I2YVQ5_PMAIP1-      -----------------RKN--------AQPSPARAP----AGPAGTARD
A0A2I3SX38_PMAIP1-      -----------------RKN--------AQPSPARAP----AGPAGTARD
C1C3S9_BAD-01           PPTERGSAFSGTNPPGFGGD--------PGHKSSPNLRRIKGKETRQRTE
F6Z067_BAD-01           LPLPFVD------PPRGAGV--------RQPVAKSSPSLRRYPGKESRLR
M3XHJ5_BCL2L11-01       QGTSDVISECGHLHPTQRPD--------QPPFVKQEGCYCIISPLSKVIA
W5QCU2_BIK-01           PGFLDDQ-GSGLPGVTSILE--------FHPISPYS-----DSPHYLAMQ
O70337_BIK-04           ----------------------------------------MFTRNQVALR
O70337_BIK-02           PQPPVASETPSMKE----------------PVRDVDLMECVEGRNQVALR
O70337_BIK-01           PQPPVASETPSMKE----------------PVRDVDLMECVEGRNQVALR
Q925D2_BIK-01           PQPAVVSGAPSMKEPVGVED--------VSPVRDLDFMRCLESRNQVALR
G1TZR9_BIK-01           PEPLLTAEVPGLTRPVEEGD--------LDLM------ECLEGSNQVALR
F1PUF4_BIK-01           -GPEVLE-VPGMTDL--VEY--------YDP----GPSPNSNNPDDVAMR
H0XAE7_BIK-01           LEPLTME-VLGMTE----------------P----NPMECLEDSDQVALR
A0A2K6FM79_BIK-01       LDPLILE-VLSIMDN--EE----------NP----DPSGCLEDSDEVALR
A0A1S3FUQ7_BIK-01       PGPRPAAGLFPITEPMGEEV--------WDPM------DCLEGSNQVALW
H0W025_BIK-01           PGPLLAEGALGVTQPLWAED--------LSPPGDTNLMECVEGSSLVALR
A0A2K5CLG5_BIK-01       VHPLTME-VVGGSDP--EED--------LDPVED--PLECMENSDALVLQ
F7FUT7_BIK-01           VDPLTME-VVGGSDP--EED--------LDPVED--PLECMENSDALALQ
A0A2K6TBD7_BIK-01       VDPLTME-VVGGSDP--EED--------PDSVED--PLECMENSDALALQ
H2P4N6_BIK-01           LEPPTME-VLGVTDS--EED--------LDPMEDFSPLECMEGSDALALR
G1S1X2_BIK-01           LEPPTME-VLGVTDP--EED--------LDPMEDFDPLQCMEGSDALAPR
G3QCT2_BIK-01           LEPPTME-VLGVTDS--EED--------LDPMEDFDSLECMEGSDALALR
A0A2R8ZXD2_BIK-01       LEPPTME-VLGVTES--EED--------LDPMEDFDSLECMEGSDALALR
H2QLU7_BIK-01           LEPPTME-VLGVTDS--EED--------LDPMEDFDSLECMEGSDALALR
Q13323_BIK-01           LEPPTME-VLGMTDS--EED--------LDPMEDFDSLECMEGSDALALR
A0A2K6MCW0_BIK-01       LEPLTME-VLGVTDP--EED--------LDPMEDFDPLECMEDSDMLALR
A0A2K6QK74_BIK-01       LEPLTME-VLGVTDP--EED--------LDPMEDFDPLECMEDSDMLALR
A0A0D9QZY8_BIK-01       LEPLTME-VLGVTDP--EED--------LDPMEDFDPLECMEDSDMLALR
A0A2K5VW94_BIK-01       LEPLTME-VLGVTDP--EED--------LDPMEDFNPLECMEDSDMLALR
A0A2K6DBJ4_BIK-01       LEPLTME-VLGVTDP--EED--------LDPMEDFDPLECIEDSDMLALR
A0A2K5J4Q7_BIK-01       LEPLTME-VLGVTDP--EED--------LDPMEDFDPLECMEDSDMLALR
A0A096NKG5_BIK-01       LEPLTME-VLGVTDP--EED--------LDPMEDFDPLECMEDSDMLALR
A0A2K5LDM6_BIK-01       LEPLTME-VLGVTDP--EED--------LDPMEDFDPLECMEDSDMLALR
A0A2K5XSA1_BIK-01       LEPLTME-VLGVTDP--EED--------LDPMEDFDPLECMEDSDMLALR
I3K7B6_BAD-01           -----MAANFTISDSESETS--------EEVGEEENQQPAGQDQESKPQT
B5X1T1_BAD-01           -----MDHTHDCVDDN---P--------ETMNEHDESDHSGTTHYPEFQR
Q4V925_BAD-02           -----MAHMFNISDDSE--T--------ETMEDSEDSSLDKHKSGSAQKK
Q4V925_BAD-03           -----MAHMFNISDDSE--T--------ETMEDSEDSSLDKHKSGSAQKK
A7MCM4_BAD-01           -----MAHMFNISDDSE--T--------ETMEDSEASSLDKHKSGSAQKK
Q4V925_BAD-04           -----MAHMFNISDDSE--T--------ETMEDSEDSSLDKHKSGSAQKK
Q4V925_BAD-01           -----MAHMFNISDDSE--T--------ETMEDSEDSSLDKHKSGSAQKK
G3Q8B3_BAD-01           -----MAAHFTISDSESEPS--------DGVEEREDGQLSSGQEQQRLQR
A0A087X8P8_BAD-01       -----MDAKFTISDSDSEPS--------EDVEERGNLQLMQVKERPLSQR
E7FBJ6_BAD-01           --------MENTSHDHQDDS--------------STLDEKERSHLKGTIK
B5XEF1_BAD-01           ---------MDYTHDCVDEC--------ESDHSGTTRNSEFQLHVSTTMS
G1SS60_BAD-01           --------------------------------------------------
Q9GL49_PMAIP1-01        SRIRGLLESAGWEELVRSQ---------PRAHQGLTSGRCGQTRREELRG
H3D8J8_BAD-01           -MAAKFSLCSDSDSEPSEEV--------EEGERGSF---------STSGR
H3ANP3_BAD-03           -----MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKT--AGLKK
H3ANP3_BAD-04           -----MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKT--AGLKK
H3ANP3_BAD-01           -----MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKT--AGLKK
H3ANP3_BAD-02           -----MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKT--AGLKK
A0A337SAW2_BAD-01       AWAQSMFQIPEFEPSEQEDS--------SPTDRGLGPSPTGDRP-RGPGK
A0A2U9BAC9_BAD-01       --MAANFTISDSESEPSEEV--------EEGEVSQPWTGPGEQV---PPR
A0A2I3TBK7_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSGK
A0A2R8Z697_BAD-02       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSSK
A0A2I2Z8C7_BAD-03       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSGK
Q92934_BAD-03           -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSGK
A0A2K5M0C1_BAD-02       -----MFQIPEFEPSEQEDS--------SSAERGLGPSLAGDRP-SDCGK
A0A2K5XJR2_BAD-02       -----MFQIPEFEPSEQEDS--------SSAERGLGPSLAGDRP-SDCGK
A0A2I3MCN5_BAD-03       -----MFQIPEFEPSEQEDS--------RSAERGLGPSPAGDKP-SDSGK
A0A2K5VCD8_BAD-02       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
F7GVS7_BAD-02           -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
A0A2K6E7J3_BAD-02       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
A0A2K5E6K7_BAD-02       -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGDRP-PGSGK
A0A2K6TG62_BAD-02       -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGDSP-PGSGK
A0A2K5E6K7_BAD-03       -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGDRP-PGSGK
A0A2K5HKW9_BAD-02       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
A0A2K6N1A1_BAD-02       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
A0A2K6PUM5_BAD-02       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
A0A2K5M0C1_BAD-03       -----MFQIPEFEPSEQEDS--------SSAERGLGPSLAGDRP-SDCGK
A0A2K5VCD8_BAD-03       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
F7GVS7_BAD-03           -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
A0A2K5XJR2_BAD-03       -----MFQIPEFEPSEQEDS--------SSAERGLGPSLAGDRP-SDCGK
A0A2I3MCN5_BAD-02       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDKP-SDSGK
A0A2K6E7J3_BAD-03       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
A0A2I2Z8C7_BAD-04       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSGK
Q92934_BAD-04           -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSGK
A0A2I3TBK7_BAD-03       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSGK
A0A2R8Z697_BAD-03       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSSK
F6SJL0_BAD-02           -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGDRP-PGSGK
A0A2K6TG62_BAD-03       -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGDSP-PGSGK
G1P8C5_BAD-01           PTAQSMFQIPEFEHSEQEDS--------SPADRGLGPCPTGDQP-PGLNK
W5P8G9_BAD-01           AWAQSMFQIPEFEQSEQEDS--------SPADRGLGPSPTGDRP-PGLSK
G3VRY4_BAD-01           -----MFQISEFEPSEPGED--------PSASTAPSLAPLRPGPRAAPGA
G3VRY4_BAD-02           -----MFQISEFEPSEPGED--------PSASTAPSLAPLRPGPRAAPGA
G3TP47_BAD-01           GGLQSMFQIPEFEQSDREDS--------TPADRGLGPSPEGYWP-SGPSD
I3MBM5_BAD-01           AWTQSMFQIPEFEPSEQEDS--------SSAEGGLGPSPAGDRP-GCG--
I3MBM5_BAD-02           AWTQSMFQIPEFEPSEQEDS--------SSAEGGLGPSPAGDRP-GCG--
A0A091DDU4_BAD-01       -----MFQIPEFEPSEQEDS--------SSEERGLGPSPIGDQL-GPS--
Q61337_BAD-02           PAAQSMFQIPEFEPSEQEDA--------SATDRGLGPSLTEDQP-GPY--
Q61337_BAD-03           -----MFQIPEFEPSEQEDA--------SATDRGLGPSLTEDQP-GPY--
A0A1U7Q4V0_BAD-01       PAAQSMFQIPEFEPSEQEDS--------NTADRGLGPSLTGDPP-GPC--
Q61337_BAD-01           PAAQSMFQIPEFEPSEQEDA--------SATDRGLGPSLTEDQP-GPY--
G1MI17_BAD-01           PTAQSMFQIPEFEPSEQEDS--------SPADRGLGPSPTGDQP-PGPGK
A0A287AEF3_BAD-01       PASQSMFQIPEFEQSEQEDS--------SPADRGLGPSPTGTDP-----Q
O35147_BAD-01           PAAQSMFQIPEFEPSEQEDA--------STTDRGLGPSLTEDQP-GPY--
M3YNE7_BAD-01           -----MFQIPEFEPSEQEDS--------SPADRGLGPSPTGDQP-PGLGK
F1MUT9_BAD-01           -----MFQIPEFEQSEQEDS--------SPADRGLGPSPTGDRP-PGLSK
Q3SYZ0_BAD-01           -----MFQIPEFEQSEQEDS--------SRADRGLGPSPTGDRP-PGLSK
F7DN67_BAD-01           -----MFQIPEFEQSEPEDS--------SPADRGLGPSPTGDWP-SDPVR
H0WVR2_BAD-01           -----MFQIPEFEPSEQEDS--------SSSDRGLGPSPSGDQP-LGPGK
H0V608_BAD-01           -----MFQIPEFEPSEQEDS--------SSEERGLGPSPTGDEL-GSS--
A0A1S3FL84_BAD-01       -----MFQIPEFEPSEQEDS--------SSADRGLGPSLC----------
A0A2K5E6K7_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGDRP-PGSGK
A0A2K6TG62_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGDSP-PGSGK
A0A0D9R491_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGNRP-SDSGK
A0A2K5M0C1_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLGPSLAGDRP-SDCGK
A0A2K5VCD8_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
F7GVS7_BAD-01           -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
A0A2K6E7J3_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
A0A2K5XJR2_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLGPSLAGDRP-SDCGK
A0A2I3MCN5_BAD-04       -----MFQIPEFEPSEQEDS--------RSAERGLGPSPAGDKP-SDSGK
A0A2K6N1A1_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
A0A2K6PUM5_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
A0A2K5HKW9_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SDSGK
B4DZQ9_BAD-01           -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSGK
A0A2K6GWV0_BAD-01       -----MFQIPEFEPSEQEDS--------SSAGRGLGPSPSGDRP-SGPGK
F6SJL0_BAD-01           -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGDRP-PGSGK
A0A2I3MCN5_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDKP-SDSGK
A0A2I2Z8C7_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSGK
A0A2I2Z8C7_BAD-02       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSGK
Q92934_BAD-01           -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSGK
Q92934_BAD-02           -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSGK
A0A2I3TBK7_BAD-02       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSGK
A0A2R8Z697_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDGP-SGSSK
A0A2J8TYJ3_BAD-01       -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGDRP-SGSSK
F1PK10_BAD-01           PTAQSMFQIPEFEPSEQEDS--------SPANRGLGPSPTGDRP-PSPGK
Q45KI9_BAD-01           -----MFQIPEFEPSEQEDS--------SPANRGLGPSPTGDRP-PSPGK
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          GDRGGGSSSSSSSSSSSSSSRGSSRGSGGEQAARSQAPPGRPGPRLTAPQ
F6RS78_BIK-01           ------------------------------DLFLDAFLHERSPEALEVPG
B2KKY9_BCL2L11-01       -----GGISMSNNQSRSPM---------------------NRTFSRSSSG
B8JK68_BCL2L11-01       -----GGISMSNNQSRSPM---------------------NRTFSRSSSG
A0A2K6KS56_BBC3-02      --------------------------------------------------
F7G1G0_HRK-01           -------------------------------------QRAAAAAQLTAAR
A0A1U7R468_HRK-01       -------------------------------------LR-WAAAQVTALR
P62816_HRK-03           -------------------------------------LR-WAAAQVTALR
P62817_HRK-01           -------------------------------------LR-WAAAQVTALR
A0A287A5N9_HRK-01       -------------------------------------LR-SSAAQLTAAR
H2NIS8_HRK-01           -------------------------------------LR-SSAAQLTAAR
A0A2K5KZ69_HRK-01       -------------------------------------LR-SSAAQLTAAR
H2Q6Y8_HRK-01           -------------------------------------LR-SSAAQLTAAR
G3UH24_HRK-01           -------------------------------------LR-SSAAQLTAAR
A0A2K5BYA0_HRK-01       -------------------------------------LR-SSAAQLTAAR
G3MWR6_HRK-01           -------------------------------------LR-SSAAQLTAAR
U3E722_HRK-01           -------------------------------------LR-SSAAQLTAAR
A0A0D9SC73_HRK-01       -------------------------------------LR-SSAAQLTAAR
A0A337SQ56_HRK-01       -------------------------------------LR-SSAAQLTAAR
G3QTJ6_HRK-01           -------------------------------------LR-SSAAQLTAAR
O00198_HRK-01           -------------------------------------LR-SSAAQLTAAR
A0A1D5R1E4_HRK-01       -------------------------------------LR-SSAAQLTAAR
A0A2K6AYL7_HRK-01       -------------------------------------LR-SSAAQLTAAR
G1QHD8_HRK-01           -------------------------------------LR-SSAAQLTAAR
G1T7W1_HRK-01           -------------------------------------LR-SAAAQLTAAR
H0Y001_HRK-01           -------------------------------------LR-SSAAQLTAAR
A0A096N944_HRK-01       -------------------------------------LR-SSAAQLTAAR
A0A2K6GL98_HRK-01       -------------------------------------LR-SSAAQLTAAR
E2RLD4_HRK-01           -------------------------------------LR-SSAAQLTAAR
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
G3SU55_BCL2L11-01       ----GEGDSCPQGSPQGPQAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
G3W979_BCL2L11-01       ----GEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFVRRSPLLPRSSSG
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A1S3FHA8_BCL2L11      --------------------------------------------------
Q4KMV9_BCL2L11-01       --QSDEGGSSSASTPWGPTISPYSPSSFVNRSPHCMLVRGSSLVSKTSSG
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      ------------------------PGPFATRSP-----------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       GNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
F7CXT2_BCL2L11-01       ---SGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFLRRSPLLPRSSSG
F6XMC1_BCL2L11-08       GNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A337SW42_BCL2L11      ----GEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSG
A0A337SW42_BCL2L11      ----GEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSG
A0A2K6GE31_BCL2L11      GSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
A0A2K6GE31_BCL2L11      GSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
A0A2K5NU92_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5HZI7_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I2YQ13_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
O43521_BCL2L11-08       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
O43521_BCL2L11-22       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5X2I7_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
F7HHA9_BCL2L11-03       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6E226_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5Z8B6_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I3HW02_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2R9CA99_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2J8JCT2_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I3M6I1_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6KJP8_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6QIL2_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5CAB2_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
F6XMC1_BCL2L11-06       GNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K6TRZ5_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K5CAB2_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K6TRZ5_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K5CAB2_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
F6XMC1_BCL2L11-04       GNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K6TRZ5_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K5NU92_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I2YQ13_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
O43521_BCL2L11-21       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5X2I7_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
F7HHA9_BCL2L11-01       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6E226_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5Z8B6_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I3HW02_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2R9CA99_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2J8JCT2_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I3M6I1_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6KJP8_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6QIL2_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5NU92_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5HZI7_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I2YQ13_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
O43521_BCL2L11-24       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
O43521_BCL2L11-12       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5X2I7_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
F7HHA9_BCL2L11-06       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6E226_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5Z8B6_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I3HW02_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2R9CA99_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2J8JCT2_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I3M6I1_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6KJP8_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6QIL2_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5HZI7_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
O54918_BCL2L11-01       ----GEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
O88498_BCL2L11-01       ----GEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
A0A1U8BW10_BCL2L11      ----GEGDRCPHGSPQGPLAPPASPGPSATRSPLFIFVRRSSLLSRSSSG
A0A287DFJ0_BCL2L11      ----GEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
A0A2K6GE31_BCL2L11      GSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
A0A2K6GE31_BCL2L11      GSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
A0A2K5CAB2_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
F6XMC1_BCL2L11-07       GNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K6TRZ5_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
F6XMC1_BCL2L11-05       GNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K6TRZ5_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K5CAB2_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K5NU92_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5HZI7_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5X2I7_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
F7HHA9_BCL2L11-02       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6E226_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5Z8B6_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I3M6I1_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6KJP8_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6QIL2_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I2YQ13_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
O43521_BCL2L11-16       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
O43521_BCL2L11-09       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2R9CA99_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2J8JCT2_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5NU92_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5HZI7_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5X2I7_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
F7HHA9_BCL2L11-04       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6E226_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5Z8B6_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I3M6I1_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6KJP8_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6QIL2_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I2YQ13_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
O43521_BCL2L11-18       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I3HW02_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2R9CA99_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2J8JCT2_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5CAB2_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K5CAB2_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
F6XMC1_BCL2L11-03       GNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K6TRZ5_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K6TRZ5_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSG
A0A2K6QIL2_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6QIL2_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5NU92_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5HZI7_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5X2I7_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6E226_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6E226_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K5Z8B6_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I3M6I1_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6KJP8_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2K6KJP8_BCL2L11      DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I2YQ13_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
O43521_BCL2L11-03       GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2I3HW02_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2R9CA99_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
A0A2J8JCT2_BCL2L11      GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSG
F1SU81_BCL2L11-02       --PEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSSLLSRSSSG
A0A337SW42_BCL2L11      --PEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSG
W5PY58_BCL2L11-01       --PEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
F7A7D2_BCL2L11-01       --PGGEGDRCPQGSPLGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSG
A0A286XJN2_BCL2L11      --PEGAGDRSPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
A0A286XJN2_BCL2L11      --PEGAGDRSPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
G1SSY0_BCL2L11-01       ----PEGDRCAHGSPQGPLAPSASPGPFATRSPLFIFVRRSSLLSRSSSG
H0XW23_BCL2L11-01       GNPEVEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
A0A1S3FHA8_BCL2L11      GSPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
A0A337SW42_BCL2L11      --PEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSG
G1LDR8_BCL2L11-01       --PEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
J9NWV6_BCL2L11-01       --PEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSG
F1SU81_BCL2L11-01       --PEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSSLLSRSSSG
A0A286XF37_PMAIP1-      RAELEVECAAQLRRVGDTLNSLGCTTEALEV-----LAEMAGKKARKS--
A0A1U7QLK6_PMAIP1-      RAELAPEFIAQLRRIGDKLSSEWCEPDIIAV-----LAEMPGKKARKSVT
Q9JM54_PMAIP1-01        RAELPPEFAAQLRKIGDKVYCTWSAPDITVV-----LAQMPGKSQKSRM-
Q5U777_PMAIP1-01        RAELPPEFAAQLRKIGDKVYCTWSAPDITAV-----LAQMPGKKSRKSTM
I3LVX0_BIK-01           LACIGDEMDLCFQDLQLAQLPGMAMHSLALS-------------------
A9XRH0_BMF-01           -------------GYRLHVPPVGFALDPNLQ-------------------
R4G9R5_BCL2L11-01       ------MLVVGSSQPQLCLLPKQLNVLSANAFAISCFLYRDVPWRRTGRR
Q6P7C5_BAD-01           PG-----LLGSIVQQ-----------------------------QPGQAA
A0A287AEF3_BAD-02       PGARPQATWGKLVTSRGSRPAAATMEALGLW-------------RPGVAT
O61667_EGL1-01          ------MLMLTFASTSSDLLPMSNVFDV--------QSSVFYNEKNMFYS
A3KND0_BMF-01           SSLFNQSQSYTCLLGRFHLFPFSHCCGPGCR-----GTDNEDKATQTL--
A0A2K5F6X4_BBC3-02      KCGVGSAWACPCQVPRASSSTWVPCQMCGPQ------------------P
A0A337SQV0_BBC3-03      LGGGGLGESCVCARARCVGVTPWVCVAC-PQ------------------P
F1SMU1_PMAIP1-01        EAFGRSGCCFSSSLPLARFCPTAPRAACYLQ-----SQGARVRGLSSRSF
Q9BXH1_BBC3-04          VPRAASTTWVPCQICETRGAAAAPPLTLEGP-----VQSHHGTPALTQGP
K7E5Y2_BBC3-02          ALAPSSLLPLAYFCTRQPRAYGGPRWARAAR-----SPAAGNQGQSGSLP
F7CQN5_BBC3-01          ----------------------------------------------GPQP
A0A2I3HWI8_BBC3-03      S----SVTWVPCQI-------------------------------C----
A0A2K6FQZ3_BBC3-04      S----FSWWVLGHI-------------------------------PGPQP
Q9BXH1_BBC3-05          A----STTWVPCQI-------------------------------CGPQP
A0A2R9BZA9_BBC3-01      A----SVTWVPCQI-------------------------------CGPQP
A0A2I3RGH5_BBC3-03      A----SATWVPCQI-------------------------------CGPQP
A0A2K5P2T8_BBC3-03      A----SATWVLCQI-------------------------------CGPQP
A0A2K5V8J3_BBC3-03      S----SATWVPCQI-------------------------------CGPQP
F7FFP6_BBC3-03          S----SATWVPCQI-------------------------------CGPQP
A0A2K6ASP2_BBC3-03      S----SATWVPCQI-------------------------------CGPQP
A0A2I3N2Z9_BBC3-03      S----SATWVPCQI-------------------------------CGPQP
A0A2K6QZU4_BBC3-04      S----SATWVPCQI-------------------------------CGPQP
A0A2R8MW85_BBC3-03      S----SSVWVPCQM-------------------------------CGPQP
A0A2K6STD6_BBC3-02      S----SLTWVPCQM-------------------------------CGSQP
G3T2N1_BBC3-01          R----TQLFPSPSPVWVSDLSGLQLERGGAE-----WEDRAPRPLSGPQP
M3Y0R3_BBC3-01          A----AAVSQPPPPPVWVSLTSQRTIVGGSV-----GRARGLLF-PGPQP
A0A1U7R5N5_BBC3-01      A----AYLCAPTAPPAVTAALGGPRWPGGPR-----SRPRGPRP-DGPQP
Q99ML1_BBC3-02          A----AYLCAPTAPPAVTAALGGPRWPGGHR-----SRPRGPRP-DGPQP
Q80ZG6_BBC3-01          A----AYLCAPTAPPAVTAALGGPRWPGGHR-----SRPRGPRP-DGPQP
H0XQ00_BBC3-01          A----AYLCAPTAPPAVTATLGGPRWPGGPR-----SRPRGPRL-DGPQP
J9NTK9_BBC3-01          A----AYLCAPTAPPAVTAALGGPRWPGGPR-----SRPRGPRP-DGPQP
A0A337SQV0_BBC3-02      A----AYLCAPTAPPAVTAALGGPRWPGGPR-----SRPRGPRP-DGPQP
F1RM01_BBC3-01          A----AYLCAPTAPPAVTAALGGPRWPGGPR-----SRPRGPRP-DGPQP
A0A2K6FQZ3_BBC3-01      A----AYLCAPTAPPAVTAALGGPRWPGGPR-----SRPRGPRP-DGPQP
Q9BXH1_BBC3-06          A----AYLCAPTAPPAVTAALGGSRWPGGPR-----SRPRGPRP-DGPQP
A0A2I3RIG5_BBC3-02      A----AYLCAPTAPPAVTAALGGPRWPGGPR-----SRPRGPRP-DGPQP
H2NZD3_BBC3-01          A----AYLCAPTAPPAVTAALGGPRWPGGPR-----SRPRGPRP-DGPQP
A0A2K6QZU4_BBC3-01      A----AYLCAPTAPPAVTAALGGPRWPGGPR-----SRPRGPRP-DGPQP
A0A0D9S2H2_BBC3-01      A----AYLCAPTAPPAVTAALGGPRWPGGPR-----SRPRGPRP-DGPQP
B4DQK3_BBC3-01          A----AYLCAPTAPPAVTAALGGSRWPGGPR-----SRPRGPRP-DGPQP
F6TGJ4_BMF-01           STVFNQSQSYTCLLSRFHLFPLSHCCGPGCR-----GADYEDKATQTLGS
G1PAU1_BMF-01           ADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PISQEDKATQTLSP
A0A1U8CPE0_BMF-02       ADPFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PISQEDKATQTLSP
A0A286XXB0_BMF-03       ADLFAQSQ-LDCPLGRLHLFPLTHCCGPGLR-----PTSQEDKATQTLSP
I3MDS9_BMF-02           ADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A287AIU8_BMF-05       ADPFVQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A287AIU8_BMF-03       ADPFVQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A287AIU8_BMF-01       ADPFVQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A287AIU8_BMF-02       ADPFVQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A287AIU8_BMF-04       ADPFVQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A1S3EQA2_BMF-02       ATLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A2AV74_BMF-02           ADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PISQEDKATQTLSP
A0A337SQV0_BBC3-01      AGAARACP-RQVP--GASFFPGC----PRERHGPSTPGGQLPGARRGPGP
Q9BXH1_BBC3-03          MGSAQACP-CQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGP
A0A2K5KGR6_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2K6FFR1_BMF-02       ADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
M3WRS0_BMF-02           ANLFAQSQ-LDCPLSHLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A2K5E1W9_BMF-02       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
F7HPK0_BMF-02           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A2K6TW86_BMF-03       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A2K6RAW8_BMF-02       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
G3QIN5_BMF-02           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
Q96LC9_BMF-07           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
Q96LC9_BMF-05           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A2R9BS98_BMF-02       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A2J8QDD5_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A2K5MJY6_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
G7PAW6_BMF-01           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2K6B5G4_BMF-03       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2K5Z4C3_BMF-02       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A096NTE9_BMF-03       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2I3HD83_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A1S3EQA2_BMF-01       ATLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
Q8K589_BMF-01           ADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PVSQEDKATQTLSP
A2AV74_BMF-01           ADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PISQEDKATQTLSP
I3MDS9_BMF-01           ADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
G3T7Z4_BMF-01           ADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----HTSQEDKATQTLSP
F6X3N6_BMF-01           AALFAQSQ-PDYMLDGLQLFPLTHCCGPGLR-----SVGQEDKATQTLSP
G3WDQ2_BMF-01           PALFAQSQ-PDYMLDGLQLFPLTHCCGPGLR-----SVGQEDKATQTLSP
A0A1S3WU31_BMF-01       SDLFAQSP-MDCSLSRLQLFPLTHCCGPGLR-----PASQEDKATQTLSP
Q96LC9_BMF-06           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A286XXB0_BMF-02       ADLFAQSQ-LDCPLGRLHLFPLTHCCGPGLR-----PTSQEDKATQTLSP
J9PB65_BMF-01           ADLFAQSQ-LDCPLSRLHLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A1U8CPE0_BMF-01       ADPFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PISQEDKATQTLSP
A0A286XXB0_BMF-01       ADLFAQSQ-LDCPLGRLHLFPLTHCCGPGLR-----PTSQEDKATQTLSP
G1SR62_BMF-01           ADPFAQSQ-LDCPLGRLHLFPLTHCCGPGLR-----PTSQEDKATQTLSP
F6TJI0_BMF-01           ADLFAPSQ-LDCPLSHLRLFPLTHCCGPGLR-----PTSQEDKATQTLSP
Q05KI3_BMF-01           ADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
W5QFV1_BMF-01           ADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
M3WRS0_BMF-01           ANLFAQSQ-LDCPLSHLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
M3YAD5_BMF-01           ADLFAQSQ-LDCPLSRLHLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A2K6FFR1_BMF-01       ADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
H0WYH6_BMF-01           ADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A096NTE9_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2K6L933_BMF-02       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A096NTE9_BMF-02       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2K5MJY6_BMF-02       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2K5KGR6_BMF-02       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
G7PAW6_BMF-02           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
F7CM09_BMF-02           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2K6B5G4_BMF-02       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2K6B5G4_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2K6B5G4_BMF-04       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2K5Z4C3_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2K6L933_BMF-03       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2K6L933_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A2K6RAW8_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
A0A0D9R4R5_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLGP
F7HPK0_BMF-01           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A2K5E1W9_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A2K6TW86_BMF-02       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A2K6TW86_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
G3QIN5_BMF-01           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
Q96LC9_BMF-01           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
Q96LC9_BMF-02           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
Q96LC9_BMF-03           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
Q96LC9_BMF-04           ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A2R9BS98_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A2J8QDD5_BMF-02       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
A0A2J8T301_BMF-01       ADLFAQSL-LDCPLSRLQLFPLTHCCGPGLR-----PTSQEDKATQTLSP
H9GL49_BMF-01           PGIFTQSKSYNCLLGRFQLFPLTHCCGPGSR-----QARQQDKATQTLNP
A9XRG9_BMF-01           TGIFTQNQSYSCLLGRFQLFPLTHCCGPGVR-----HPEQQDKATQTLSP
K7FRX2_BMF-01           TGIFTQNQSYSCLLGRFQLFPLTHCCGPGIR-----HAEQQDKATQTLSP
U3JS06_BMF-01           TGFFTQNQSYSCLLGRFQLFPLTHCCGPGIR-----HPEQQDKATQTLSP
H0ZMX5_BMF-01           TGFFTQNQSYSCLLGRFQLFPLTHCCGPGIR-----HPEQQDKATQTLSP
A9XRG9_BMF-02           TGIFTQNQSYSCLLGRFQLFPLTHCCGPGVR-----HPEQQDKATQTLSP
A9XRG9_BMF-03           TGIFTQNQSYSCLLGRFQLFPLTHCCGPGVR-----HPEQQDKATQTLSP
G1NHG8_BMF-01           TGIFTQNQSYSCLLGRFQLFPLTHCCGPGVR-----HPEQQDKATQTLSP
W5N4P7_BMF-01           ---------------------FSHCWGTQFR-----EIKYEDKGTQTPSP
I3K2D6_BMF-01           ----------------------ANCWRTTFR-----EIKCEHRGTQTPGP
A0A096LRV0_BMF-01       ----------------------PNCWRTPFR-----EIKCEDRGTQTPGP
A0A2U9CJH3_BMF-01       ----------------------PHCWRTTFR-----EIKCEDRGTQTPGP
Q0GKC7_BMF-01           PAGSRNGMLLCRHLQQHG------HFLYGNA-----ELLVLAASSRAQPP
A0A2K5JY52_PMAIP1-      QAGRGRG------RGKKLL-----SSPLALP-----RGHEEQVQVAR---
A0A096MPU8_PMAIP1-      QAGFGIGMQLHFTRSKKLV----SSSPLALP-----RGHEEQVQVAR---
A0A2K5ZWH1_PMAIP1-      QAGFGIGMQLHFTRGKKLV----SSSPLALP-----RGHEEQVQVAR---
A0A2K5VPX2_PMAIP1-      QAGFGIGMQLHYTRGKKLV----SSSPLVLP-----RGHEEQVQVAR---
A0A2K6BV75_PMAIP1-      QAGFGIGMQLHYTRGKKLV----SSSPLVLP-----RGHEEQVQVAR---
A0A2K6KJF2_PMAIP1-      QAGLGIGMQLHFTRGKKLL----SSSPLALP-----RGHEEQVQVAR---
A0A2K6NC45_PMAIP1-      QAGLGIGMQLHFTRGKKLL----SSSPLALP-----RGHEEQVQVAR---
Q13794_PMAIP1-02        QAGFAIGMQLRFTRGKKLLSSSLSSSPLALP-----RGHEEQVQVAG---
A0A2R9AKC9_PMAIP1-      QAGFGIGMQLRFTRGKKLLSSS-SSSPLALP-----RGHEEQAQVAG---
A0A1D5QGJ8_PMAIP1-      QAGFGIGMQLHYTRGKKLVSSS----PLVLP-----RGHEEQVQVAR---
A0A2I2YVQ5_PMAIP1-      QAGFGIEMQLRFTRGKKLLSSS----PLALP-----RGHEEQVQVAG---
A0A2I3SX38_PMAIP1-      QAGFGIGMQLRFTRGKKLLSSSLSSWPLALP-----RGHEEQVQVAG---
C1C3S9_BAD-01           SASEASETDSVGELQHFRSRSRSAPSSLMVA-----ARYGRE------LR
F6Z067_BAD-01           TESASESSETD-KVGELHPFRSRSRSAPSSM-----IATKYGRELRRMSD
M3XHJ5_BCL2L11-01       LVRWRDRSLLSTLMGGLLLPPSPCPFVTRSP-----FFIFMRRSL--VLS
W5QCU2_BIK-01           LASIADEMELRLLLPQFVEPFWMPMYSLCFP-----Y---SHVGLRDVLR
O70337_BIK-04           LACIGDEMDLCLRSPRLVQLPGIAIHRLAVT-----Y---SRTGVRGIFR
O70337_BIK-02           LACIGDEMDLCLRSPRLVQLPGIAIHRLAVT-----Y---SRTGVRGIFR
O70337_BIK-01           LACIGDEMDLCLRSPRLVQLPGIAIHRLAVT-----Y---SRTGVRGIFR
Q925D2_BIK-01           LACIGDEMDRCLRSPRLVQLPGIAMHRLAAT-----Y---SQTGVRGIFR
G1TZR9_BIK-01           LAYIGDEMDLHVRGLHTGPAAGVAMHSLAFT-----Y---SQTGFTGVLG
F1PUF4_BIK-01           LAFIGDEMEVRWMLPRVGELPGMAMYSLA-------FTYNQT-GLRGVLR
H0XAE7_BIK-01           LACIGDEMDLHLRSPRLAQLSRMTMHSLG-------LSYNQT-DGQGVLR
A0A2K6FM79_BIK-01       LACIGDEMDLCLRSPRLAWLPGMTMHSLGLA-----LSCDQP-VRWGVLG
A0A1S3FUQ7_BIK-01       LVCIGDEMDQRLRSPRLAQLPGMAIHSLALT-----Y---SQMGVWGVLR
H0W025_BIK-01           LACIGDEMDLRLRSPRLAQLPGRAVHSLAIT-----Y---SQMGLWGVLG
A0A2K5CLG5_BIK-01       LACIADQMDVSLRARRLAQLYEVAMYSPGLA-----FILDRT-DIGDVLS
F7FUT7_BIK-01           LACIADQMDVSLRARRLAQLYEVAMYSPGLA-----FVLDRT-DIGDVLS
A0A2K6TBD7_BIK-01       LACIADQMDVSLRARRLAQLYEVATYSPGLA-----FILDRT-DIRDVLS
H2P4N6_BIK-01           LACIGDEMDVSLRAPRRAQLPEVAMHSLGLA-----FIYDQTEDIRDVLR
G1S1X2_BIK-01           LACIGDEMDVSLRAPRLAQLSEVAMHSLGLA-----FIYDQTEDIRDVLR
G3QCT2_BIK-01           LACIGDEMDVSLRAPRLAQLSEVAMHSLGLA-----FIYDQTEDIRDVLR
A0A2R8ZXD2_BIK-01       LACIGDEMDVSLRAPRLAQLSDVAMHSLGLA-----FIYDQTEDIRDVLR
H2QLU7_BIK-01           LACIGDEMDVSLRAPRLAQLSDVAMHSLGLA-----FIYDQTEDIRDVLR
Q13323_BIK-01           LACIGDEMDVSLRAPRLAQLSEVAMHSLGLA-----FIYDQTEDIRDVLR
A0A2K6MCW0_BIK-01       LACIGDEMDVSLRAPRLAQLSEVAMHSLGLA-----FIYDQTDDIRDVLT
A0A2K6QK74_BIK-01       LACIGDEMDVSLRAPRLAQLSEVAMHSLGLA-----FIYDQTDDIRDVLT
A0A0D9QZY8_BIK-01       LACIGDEMDVSLRAPRLAQLSEVAMHSLGLA-----FIYDQTDDIRDVLR
A0A2K5VW94_BIK-01       LACIGDEMDVSLRAPRLAQLSEVAMHSLGLA-----FIYDQMDDIRDVLR
A0A2K6DBJ4_BIK-01       LACIGDEMDVSLRAPRLAQLSEVAMHSLGLA-----FIYDQMDDIRDVLR
A0A2K5J4Q7_BIK-01       LACIGDEMDVSLRAPRLAQLSEVAMHSLGLA-----FIYDQTDDIRDVLR
A0A096NKG5_BIK-01       LACIGDEMDVSLRAPRLAQLSEVAMHSLGLA-----FIYDQTDDIRDVLR
A0A2K5LDM6_BIK-01       LACIGDEMDVSLRAPRLAQLSEVAMHSLGLA-----FICDQTDDIRDVLR
A0A2K5XSA1_BIK-01       LACIGDEMDVSLRAPRLAQLSEVAMHSLGLA-----FIYDQTDDIRDVLR
I3K7B6_BAD-01           LALPVIKT-------TVQ----PNQWNALGM-----RDEDLMARGED--E
B5X1T1_BAD-01           HYVSTRTGIRPRPGGRVR-LYSESQVCSQVG-----RRDNTEFQDVMTPT
Q4V925_BAD-02           QHLTVPD--------RLK----GEQ----LG-----RQRNLSMNEEDLLE
Q4V925_BAD-03           QHLTVPD--------RLK----GEQ----LG-----RQRNLSMNEEDLLE
A7MCM4_BAD-01           QHLTVPD--------RLK----GEQ----LG-----RQRNLSMNEEDLLE
Q4V925_BAD-04           QHLTVPD--------RLK----GEQ----LG-----RQRNLSMNEEDLLE
Q4V925_BAD-01           QHLTVPD--------RLK----GEQ----LG-----RQRNLSMNEEDLLE
G3Q8B3_BAD-01           HTLTLPEL-------RLS----GRKSQRIVE-----KEEELWL---D--E
A0A087X8P8_BAD-01       HTLTLPELRSTTGRVRLN----SESIASTIS-----REEELQARGEE--E
E7FBJ6_BAD-01           NHGQHQDRTSANISPQGR-VRLYSESQ-VYT------VSRWQDTETQD--
B5XEF1_BAD-01           NRPR----------PGER-VRLYSESQ-VRS-----QVGKREDTEFQDVM
G1SS60_BAD-01           -------------------PRPKPLSA-GAG-----AMETR--SRHSSYP
Q9GL49_PMAIP1-01        SFGPPPAAVRGNQ------PTSEAFGRSGCC-----FSSSLPLARFCPTA
H3D8J8_BAD-01           IRVNSESQASAVSRDEEL--------------------------------
H3ANP3_BAD-03           HSRTAPNLQNPGPHQSHP-PSHTGVYG-WVK-----LRKRNNMEILGRPS
H3ANP3_BAD-04           HSRTAPNLQNPGPHQSHP-PSHTVFWG-FT----------DNMEILGRPS
H3ANP3_BAD-01           HSRTAPNLQNPGPHQSHP-PSH-------T----------DNMEILGRPS
H3ANP3_BAD-02           HSRTAPNLQNPGPHQSHP-PSH-------T----------DNMEILGRPS
A0A337SAW2_BAD-01       HQRTTPGLLGEAGHQQGQ-PASSNHHG-GAG-----AVETR--SRHSSYP
A0A2U9BAC9_BAD-01       HTLALPELRMAATGRIRLNSESNASTL----------------SRDEELL
A0A2I3TBK7_BAD-01       HHRQAPGLLWDASHQQEQ-PTSSSHHG-EGT-------SSPEERGHSNPD
A0A2R8Z697_BAD-02       HHRQAPGLLWDASHQQEQ-PTSSSHHG-EGT-------SSPEERGHSNAD
A0A2I2Z8C7_BAD-03       HHRQAPGLLWDASHQQEQ-PTSSSHHG-EGT-------SSPEERRHSNAD
Q92934_BAD-03           HHRQAPGLLWDASHQQEQ-PTSSSHHG-EGT-------SSPEERGHSNAD
A0A2K5M0C1_BAD-02       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GT--------SSPEERGHSDAD
A0A2K5XJR2_BAD-02       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GT--------SSPEERGHSDAD
A0A2I3MCN5_BAD-03       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GT--------SSPEERGHSDAD
A0A2K5VCD8_BAD-02       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GT--------SSPEERGHSDAD
F7GVS7_BAD-02           HHRQAPGLLWDASHQQEQ-PTSSSHHG-GT--------SSPEERGHSDAD
A0A2K6E7J3_BAD-02       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GT--------SSPEERGHSDAD
A0A2K5E6K7_BAD-02       HPRQAPGLPGDASHQQGQ-PTSSSHHG-GT--------SSPEERGHSNAD
A0A2K6TG62_BAD-02       HRRQAPGLPGDASHQQGQ-PTSSSHHG-GT--------SSPEERGHSNAD
A0A2K5E6K7_BAD-03       HPRQAPGLPGDASHQQGQ-PTSSSHHG-GE-------YSTCASASSSENP
A0A2K5HKW9_BAD-02       HHRQAPGLLWDASHQQEQ-ATSSSHHG-GRA-----WYSPS-ESEDSENP
A0A2K6N1A1_BAD-02       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GRA-----WYYPA-ESEDSENP
A0A2K6PUM5_BAD-02       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GRA-----WYYPA-ESEDSENP
A0A2K5M0C1_BAD-03       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GGA-----WYSPSWESEDSENP
A0A2K5VCD8_BAD-03       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GRA-----WYSPSWESEDSENP
F7GVS7_BAD-03           HHRQAPGLLWDASHQQEQ-PTSSSHHG-GRA-----WYSPSWESEDSENP
A0A2K5XJR2_BAD-03       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GGA-----WYSPSWESEDSENP
A0A2I3MCN5_BAD-02       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GRA-----WYSPSWESEDSENP
A0A2K6E7J3_BAD-03       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GRA-----WYSPSWESEDSENP
A0A2I2Z8C7_BAD-04       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GRT-----SYSPSWESEDSENP
Q92934_BAD-04           HHRQAPGLLWDASHQQEQ-PTSSSHHG-GRT-----SYSPSWESEDSENP
A0A2I3TBK7_BAD-03       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GRT-----SYSPSWESEDSENP
A0A2R8Z697_BAD-03       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GRT-----SYSPSWESEDSENP
F6SJL0_BAD-02           HRRQAPGLPGDASHQQGQ-STSSSHHG--------------------ENP
A0A2K6TG62_BAD-03       HRRQAPGLPGDASHQQGQ-PTSSSHHG--------------------ENP
G1P8C5_BAD-01           HWSTVPGLLGEAGHQQGQ-PASSSHHD-GAG-----SVEPR--SRHSSYP
W5P8G9_BAD-01           HWLTAPGLLGEAGHQQGQ-PAGSSHHG-GTG-----AVETR--SRHSSYP
G3VRY4_BAD-01           HHHEGAGAGRPRLISYPPL---------------------REGSREASPE
G3VRY4_BAD-02           HHHEKGGAQKSQTHVSKELKASASQGRLGKG-----SFEGREGSREASPE
G3TP47_BAD-01           RHRVAPGFLRDSSHQQGQ-PTSSGHHG-GAA-----AVETR--SRHSSYP
I3MBM5_BAD-01           ---LAPGLPRDTGHQQWQ-ATSSSNHG-GAG-----ATETR--SRHSSYP
I3MBM5_BAD-02           ---LAPGLPRDTGHQQWQ-ATSSSNHG-GAG-----ATETR--SRHSSYP
A0A091DDU4_BAD-01       ---PARGFLGDTSHQQRQ-LFSSRHHG-GAG-----AMETR--SRHSSYP
Q61337_BAD-02           ---LAPGLLGSNIHQQGR-AATNSHHG-GAG-----AMETR--SRHSSYP
Q61337_BAD-03           ---LAPGLLGSNIHQQGR-AATNSHHG-GAG-----AMETR--SRHSSYP
A0A1U7Q4V0_BAD-01       ---LAPGLLGNIRHQQEQ-AANSSHHG-GTG-----AMETR--SRHSSYT
Q61337_BAD-01           ---LAPGLLGSNIHQQGR-AATNSHHG-GAG-----AMETR--SRHSSYP
G1MI17_BAD-01           HRQTAPGLLGEAAHPQGQ-PASSNHHG-GAG-----AVEPR--SRHSSYP
A0A287AEF3_BAD-01       PWRTAPGHLGEAGHQQGQ-PASSSHHG-GAG-----AVETR--SRHSSYP
O35147_BAD-01           ---LAPGLLGSIVQQQPGQAANNSHHG-GAG-----TMETR--SRHSSYP
M3YNE7_BAD-01           HLQTAPGLLGEAGHQQGQ-PASSSHHG-GAG-----AVETR--SRHSSYP
F1MUT9_BAD-01           HWLTAPGLLGEAGHQQGQ-PAGSSHHG-GTG-----AVETR--SRHSSYR
Q3SYZ0_BAD-01           HWLTAPGLLGEAGHQQGQ-PAGSSHHG-GTG-----AVETR--SRHSSYR
F7DN67_BAD-01           HQRTAPGLLGEAGHQQGQ-PASSSHHG-GAG-----AVETR--SRHSSYP
H0WVR2_BAD-01           NRCTTPSLLGDASHLQGQ-PASNTHHGAGPG-----AVETR--SRHSSYP
H0V608_BAD-01           ---PAGGFLGDTSHQQRQLRSSRSHHG-GTV-----AMETR--SRHRSYP
A0A1S3FL84_BAD-01       ---PAPGLLGDHSPQQGL-PTSRSHHG-GAG-----AVETR--SRHSSYP
A0A2K5E6K7_BAD-01       HPRQAPGLPGDASHQQGQ-PTSSSHHG-GAG-----AVETR--SRHSSYP
A0A2K6TG62_BAD-01       HRRQAPGLPGDASHQQGQ-PTSSSHHG-GAG-----AVETR--SRHSSYP
A0A0D9R491_BAD-01       HHHQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVETR--SRHSSYP
A0A2K5M0C1_BAD-01       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVETR--SRHSSYP
A0A2K5VCD8_BAD-01       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVETR--SRHSSYP
F7GVS7_BAD-01           HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVETR--SRHSSYP
A0A2K6E7J3_BAD-01       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVETR--SRHSSYP
A0A2K5XJR2_BAD-01       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVETR--SRHSSYP
A0A2I3MCN5_BAD-04       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVETR--SRHSSYP
A0A2K6N1A1_BAD-01       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVETR--SRHSSYP
A0A2K6PUM5_BAD-01       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVETR--SRHSSYP
A0A2K5HKW9_BAD-01       HHRQAPGLLWDASHQQEQ-ATSSSHHG-GAG-----AVETR--SRHSSHP
B4DZQ9_BAD-01           HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVEIR--SRHSSYP
A0A2K6GWV0_BAD-01       HPCTAPSFLGDASHQQGQ-PSSSSHHG-GAG-----SVETR--SRHSSYP
F6SJL0_BAD-01           HRRQAPGLPGDASHQQGQ-STSSSHHG-GAG-----AVETR--SRHSSYP
A0A2I3MCN5_BAD-01       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVETR--SRHSSYP
A0A2I2Z8C7_BAD-01       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVEIR--SRHSSYP
A0A2I2Z8C7_BAD-02       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVEIR--SRHSSYP
Q92934_BAD-01           HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVEIR--SRHSSYP
Q92934_BAD-02           HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVEIR--SRHSSYP
A0A2I3TBK7_BAD-02       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVEIR--SRHSSYP
A0A2R8Z697_BAD-01       HHRQAPGLLWDASHQQEQ-PTSSSHHG-GAG-----AVEIR--SRHSSYP
A0A2J8TYJ3_BAD-01       HHRQAPGLLRDASHQQEQ-PTSSSHHG-GAG-----AVEIR--SRHSSYP
F1PK10_BAD-01           HQQTAPGLLGEAGHQQGQ-PASRKHHG-GAG-----A-ETR--SRHSSFP
Q45KI9_BAD-01           HQQTAPGLLGEAGHQQGQ-PASRKHHG-GAG-----A-ETR--SRHSSFP
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          ARPRRRVHAPGGLGVGLRSGECAPRLGVRVPCRERGPLSPRCCCRCECGA
F6RS78_BIK-01           MTELTDSQSPSPQGE-----------------------------------
B2KKY9_BCL2L11-01       YFSVDSDSVPGSPLM-----------------------------------
B8JK68_BCL2L11-01       YFSVDSDSVPGSPLM-----------------------------------
A0A2K6KS56_BBC3-02      ------AQYRRRRQE-----------------------------------
F7G1G0_HRK-01           LKALGDELQERTMWR-----------------------------------
A0A1U7R468_HRK-01       LQALGDELHRRAM-R-----------------------------------
P62816_HRK-03           LQALGDELHRRAM-R-----------------------------------
P62817_HRK-01           LQALGDELHRRAM-R-----------------------------------
A0A287A5N9_HRK-01       LKALGDELHQRTMWR-----------------------------------
H2NIS8_HRK-01           LKALGDELHQRTMWR-----------------------------------
A0A2K5KZ69_HRK-01       LKALGDELHQRTMWR-----------------------------------
H2Q6Y8_HRK-01           LKALGDELHQRTMWR-----------------------------------
G3UH24_HRK-01           LKALGDELHQRTMWR-----------------------------------
A0A2K5BYA0_HRK-01       LKALGDELHQRTMWR-----------------------------------
G3MWR6_HRK-01           LKALGDELHQRTMWR-----------------------------------
U3E722_HRK-01           LKALGDELHQRTMWR-----------------------------------
A0A0D9SC73_HRK-01       LKALGDELHQRTMWR-----------------------------------
A0A337SQ56_HRK-01       LKALGDELHQRTMWR-----------------------------------
G3QTJ6_HRK-01           LKALGDELHQRTMWR-----------------------------------
O00198_HRK-01           LKALGDELHQRTMWR-----------------------------------
A0A1D5R1E4_HRK-01       LKALGDELHQRTMWR-----------------------------------
A0A2K6AYL7_HRK-01       LKALGDELHQRTMWR-----------------------------------
G1QHD8_HRK-01           LKALGDELHQRTMWR-----------------------------------
G1T7W1_HRK-01           LKALGDELHQRTMWR-----------------------------------
H0Y001_HRK-01           LKALGDELHQRTMWR-----------------------------------
A0A096N944_HRK-01       LKALGDELHQRTMWR-----------------------------------
A0A2K6GL98_HRK-01       LKALGDELHQRTMWR-----------------------------------
E2RLD4_HRK-01           LKALGDELHQRTMWR-----------------------------------
F7GVS7_BAD-04           ---FKVSAGPPPRPP-----------------------------------
Q2PG01_BAD-01           ---FK----GLPRPK-----------------------------------
A0A2I3H4B2_BAD-01       ---FK----GLPRPK-----------------------------------
K7GA86_BCL2L11-01       ------DRSPVPMSC-----------------------------------
G3SU55_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
G3W979_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
A0A1U8BW10_BCL2L11      ------DRSPAPMSC-----------------------------------
O54918_BCL2L11-03       ------DRSPAPMSC-----------------------------------
O43521_BCL2L11-19       ------DRSPAPMSC-----------------------------------
O43521_BCL2L11-07       ------DRSPAPMSC-----------------------------------
A0A2I3HW02_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K6TRZ5_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K5HZI7_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K5NU92_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K5Z8B6_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2I2YQ13_BCL2L11      ------DRSPAPMSC-----------------------------------
O43521_BCL2L11-23       ------DRSPAPMSC-----------------------------------
A0A2R9CA99_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2J8JCT2_BCL2L11      ------DRSPAPMSC-----------------------------------
F7HHA9_BCL2L11-07       ------DRSPAPMSC-----------------------------------
A0A2K5CAB2_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K5X2I7_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2I3M6I1_BCL2L11      ------DRSPAPMSC-----------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K5Z8B6_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K6KJP8_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K6QIL2_BCL2L11      ------DRSPAPMSC-----------------------------------
F6XMC1_BCL2L11-09       ------DRSPAPMSC-----------------------------------
A0A2K6TRZ5_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K5HZI7_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2R9CA99_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2J8JCT2_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K5NU92_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K5X2I7_BCL2L11      ------DRSPAPMSC-----------------------------------
F7HHA9_BCL2L11-09       ------DRSPAPMSC-----------------------------------
A0A2K6E226_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2I3M6I1_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2I2YQ13_BCL2L11      ------DRSPAPMSC-----------------------------------
O43521_BCL2L11-06       ------DRSPAPMSC-----------------------------------
O43521_BCL2L11-15       ------DRSPAPMSC-----------------------------------
A0A2I3HW02_BCL2L11      ------DRSPAPMSC-----------------------------------
F1SU81_BCL2L11-03       ------DRSPAPMSC-----------------------------------
A0A0D9RWE0_BCL2L11      ------DRSPAPMSC-----------------------------------
O43521_BCL2L11-05       ------DRSPAPMSC-----------------------------------
O43521_BCL2L11-25       ------DRSPAPMSC-----------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
A0A1U8BW10_BCL2L11      ------DRSPAPMSC-----------------------------------
Q2YDF0_BCL2L11-01       ------DRSPAPMSC-----------------------------------
A0A287DFJ0_BCL2L11      ------DRSPAPMSC-----------------------------------
O54918_BCL2L11-05       ------DRSPAPMSC-----------------------------------
O88498_BCL2L11-02       ------DRSPAPMSC-----------------------------------
A0A2K6GE31_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K5CAB2_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K6TRZ5_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K6QIL2_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K5NU92_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K5HZI7_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K5X2I7_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K6E226_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K5Z8B6_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2I3M6I1_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2I3M6I1_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2K6KJP8_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2I2YQ13_BCL2L11      ------DRSPAPMSC-----------------------------------
O43521_BCL2L11-02       ------DRSPAPMSC-----------------------------------
A0A2R9CA99_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A2J8JCT2_BCL2L11      ------DRSPAPMSC-----------------------------------
H2P5E2_BCL2L11-01       ------DRSPAPMSC-----------------------------------
A0A337SW42_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A286XJN2_BCL2L11      ------DRSPAPMSC-----------------------------------
A0A1S3FHA8_BCL2L11      ------DRSPAPMSC-----------------------------------
Q4KMV9_BCL2L11-01       YFSFEV--SPGPVSC-----------------------------------
F7FTC8_BCL2L11-01       ------DRSPPPVSC-----------------------------------
A0A2K6E226_BCL2L11      --------------C-----------------------------------
M3YDI3_BCL2L11-01       ------DRSPAPMSC-----------------------------------
F6XMC1_BCL2L11-02       ------DRSPAPMSC-----------------------------------
F6XMC1_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
F7CXT2_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
F6XMC1_BCL2L11-08       YFSFDTDRSPAPMSC-----------------------------------
A0A337SW42_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A337SW42_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6GE31_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6GE31_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5NU92_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5HZI7_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I2YQ13_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
O43521_BCL2L11-08       YFSFDTDRSPAPMSC-----------------------------------
O43521_BCL2L11-22       YFSFDTDRSPAPMSC-----------------------------------
A0A2K5X2I7_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
F7HHA9_BCL2L11-03       YFSFDTDRSPAPMSC-----------------------------------
A0A2K6E226_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5Z8B6_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I3HW02_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2R9CA99_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2J8JCT2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I3M6I1_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6KJP8_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6QIL2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5CAB2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
F6XMC1_BCL2L11-06       YFSFDTDRSPAPMSC-----------------------------------
A0A2K6TRZ5_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5CAB2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6TRZ5_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5CAB2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
F6XMC1_BCL2L11-04       YFSFDTDRSPAPMSC-----------------------------------
A0A2K6TRZ5_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5NU92_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I2YQ13_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
O43521_BCL2L11-21       YFSFDTDRSPAPMSC-----------------------------------
A0A2K5X2I7_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
F7HHA9_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
A0A2K6E226_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5Z8B6_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I3HW02_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2R9CA99_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2J8JCT2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I3M6I1_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6KJP8_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6QIL2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5NU92_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5HZI7_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I2YQ13_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
O43521_BCL2L11-24       YFSFDTDRSPAPMSC-----------------------------------
O43521_BCL2L11-12       YFSFDTDRSPAPMSC-----------------------------------
A0A2K5X2I7_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
F7HHA9_BCL2L11-06       YFSFDTDRSPAPMSC-----------------------------------
A0A2K6E226_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5Z8B6_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I3HW02_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2R9CA99_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2J8JCT2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I3M6I1_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6KJP8_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6QIL2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5HZI7_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
O54918_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
O88498_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
A0A1U8BW10_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A287DFJ0_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6GE31_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6GE31_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5CAB2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
F6XMC1_BCL2L11-07       YFSFDTDRSPAPMSC-----------------------------------
A0A2K6TRZ5_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
F6XMC1_BCL2L11-05       YFSFDTDRSPAPMSC-----------------------------------
A0A2K6TRZ5_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5CAB2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5NU92_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5HZI7_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5X2I7_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
F7HHA9_BCL2L11-02       YFSFDTDRSPAPMSC-----------------------------------
A0A2K6E226_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5Z8B6_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I3M6I1_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6KJP8_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6QIL2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I2YQ13_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
O43521_BCL2L11-16       YFSFDTDRSPAPMSC-----------------------------------
O43521_BCL2L11-09       YFSFDTDRSPAPMSC-----------------------------------
A0A2R9CA99_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2J8JCT2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5NU92_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5HZI7_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5X2I7_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
F7HHA9_BCL2L11-04       YFSFDTDRSPAPMSC-----------------------------------
A0A2K6E226_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5Z8B6_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I3M6I1_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6KJP8_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6QIL2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I2YQ13_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
O43521_BCL2L11-18       YFSFDTDRSPAPMSC-----------------------------------
A0A2I3HW02_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2R9CA99_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2J8JCT2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5CAB2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5CAB2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
F6XMC1_BCL2L11-03       YFSFDTDRSPAPMSC-----------------------------------
A0A2K6TRZ5_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6TRZ5_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6QIL2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6QIL2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5NU92_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5HZI7_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5X2I7_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6E226_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6E226_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K5Z8B6_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I3M6I1_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6KJP8_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2K6KJP8_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2I2YQ13_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
O43521_BCL2L11-03       YFSFDTDRSPAPMSC-----------------------------------
A0A2I3HW02_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2R9CA99_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A2J8JCT2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
F1SU81_BCL2L11-02       YFSFDTDRSPAPMSC-----------------------------------
A0A337SW42_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
W5PY58_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
F7A7D2_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
A0A286XJN2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A286XJN2_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
G1SSY0_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
H0XW23_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
A0A1S3FHA8_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
A0A337SW42_BCL2L11      YFSFDTDRSPAPMSC-----------------------------------
G1LDR8_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
J9NWV6_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
F1SU81_BCL2L11-01       YFSFDTDRSPAPMSC-----------------------------------
A0A286XF37_PMAIP1-      -SEPDPARARAEL-------------------------------------
A0A1U7QLK6_PMAIP1-      -RIPSPTRVPTDV-------------------------------------
Q9JM54_PMAIP1-01        -RSPSPTRVPADL-------------------------------------
Q5U777_PMAIP1-01        RRSPSPTRVPADL-------------------------------------
I3LVX0_BIK-01           -----------YS-------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       WCEAETSRWQSRPIP-----------------------------------
Q6P7C5_BAD-01           NNSHHGGRFLTSIIF-----------------------------------
A0A287AEF3_BAD-02       ALTQRGPRRMKGLRM-----------------------------------
O61667_EGL1-01          SSQDFSSCEDSSQ-------------------------------------
A3KND0_BMF-01           GSPSQDIMLPCGV-------------------------------------
A0A2K5F6X4_BBC3-02      SLSLAEQHLESPV-------------------------------------
A0A337SQV0_BBC3-03      SLSPAEQHLESPV-------------------------------------
F1SMU1_PMAIP1-01        AAKFRLLF------------------------------------------
Q9BXH1_BBC3-04          QSPRDGAQLGACT-------------------------------------
K7E5Y2_BBC3-02          SLGPRSAQEEGGQEG-----------------------------------
F7CQN5_BBC3-01          SLLPAEQHLESPV-------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      SLSLAEQHLESPV-------------------------------------
Q9BXH1_BBC3-05          SLSLAEQHLESPV-------------------------------------
A0A2R9BZA9_BBC3-01      SLSLAEQHLESPV-------------------------------------
A0A2I3RGH5_BBC3-03      SLSLAEQHLESPV-------------------------------------
A0A2K5P2T8_BBC3-03      SLLLAEQHLESPV-------------------------------------
A0A2K5V8J3_BBC3-03      SLLLAEQHLESPV-------------------------------------
F7FFP6_BBC3-03          SLLLAEQHLESPV-------------------------------------
A0A2K6ASP2_BBC3-03      SLLLAEQHLESPV-------------------------------------
A0A2I3N2Z9_BBC3-03      SLLLAEQHLESPV-------------------------------------
A0A2K6QZU4_BBC3-04      SLSLAEQHLESPV-------------------------------------
A0A2R8MW85_BBC3-03      SLSLAEQHLESPV-------------------------------------
A0A2K6STD6_BBC3-02      SLSLAEQHLESPV-------------------------------------
G3T2N1_BBC3-01          SLSPAEQHLESPV-------------------------------------
M3Y0R3_BBC3-01          SLSPAEPHLESPV-------------------------------------
A0A1U7R5N5_BBC3-01      SLSPAQQHLESPV-------------------------------------
Q99ML1_BBC3-02          SLSPAQQHLESPV-------------------------------------
Q80ZG6_BBC3-01          SLSPAQQHLESPV-------------------------------------
H0XQ00_BBC3-01          SLLPAEQHLESPV-------------------------------------
J9NTK9_BBC3-01          SLSPAEQHLESPV-------------------------------------
A0A337SQV0_BBC3-02      SLSPAEQHLESPV-------------------------------------
F1RM01_BBC3-01          SLSPAEQHLESPV-------------------------------------
A0A2K6FQZ3_BBC3-01      SLSLAEQHLESPV-------------------------------------
Q9BXH1_BBC3-06          SLSLAEQHLESPV-------------------------------------
A0A2I3RIG5_BBC3-02      SLSLAEQHLESPV-------------------------------------
H2NZD3_BBC3-01          SLSLAEQHLESPV-------------------------------------
A0A2K6QZU4_BBC3-01      SLSLAEQHLESPV-------------------------------------
A0A0D9S2H2_BBC3-01      SLSLAEQHLESPV-------------------------------------
B4DQK3_BBC3-01          SLSLAEQHLESPV-------------------------------------
F6TGJ4_BMF-01           PSISQDIMLPCGV-------------------------------------
G1PAU1_BMF-01           ASPSQGVMLPCGV-------------------------------------
A0A1U8CPE0_BMF-02       ASPSQGVMLPCGV-------------------------------------
A0A286XXB0_BMF-03       SSPSQGVMLPCGV-------------------------------------
I3MDS9_BMF-02           ASPSQGVMLPCGV-------------------------------------
A0A287AIU8_BMF-05       ASPSQGVMLPCGV-------------------------------------
A0A287AIU8_BMF-03       ASPSQGVMLPCGV-------------------------------------
A0A287AIU8_BMF-01       ASPSQGVMLPCGV-------------------------------------
A0A287AIU8_BMF-02       ASPSQGVMLPCGV-------------------------------------
A0A287AIU8_BMF-04       ASPSQGVMLPCGV-------------------------------------
A0A1S3EQA2_BMF-02       ASPSQGVMLPCGV-------------------------------------
A2AV74_BMF-02           ASPSQGVMLPCGV-------------------------------------
A0A337SQV0_BBC3-01      RRPAPLSPQPPGA-------------------------------------
Q9BXH1_BBC3-03          RRPAPLPARPPGA-------------------------------------
A0A2K5KGR6_BMF-01       ASPSQGVMLPCGV-------------------------------------
A0A2K6FFR1_BMF-02       ASPSQGVMLPCGV-------------------------------------
M3WRS0_BMF-02           ASPSQGVMLPCGV-------------------------------------
A0A2K5E1W9_BMF-02       ASPSQGVMLPCGV-------------------------------------
F7HPK0_BMF-02           ASPSQGVMLPCGV-------------------------------------
A0A2K6TW86_BMF-03       ASPSQGVMLPCGV-------------------------------------
A0A2K6RAW8_BMF-02       ASPSQGVMLPCGV-------------------------------------
G3QIN5_BMF-02           ASPSQGVMLPCGV-------------------------------------
Q96LC9_BMF-07           ASPSQGVMLPCGV-------------------------------------
Q96LC9_BMF-05           ASPSQGVMLPCGV-------------------------------------
A0A2R9BS98_BMF-02       ASPSQGVMLPCGV-------------------------------------
A0A2J8QDD5_BMF-01       ASPSQGVMLPCGV-------------------------------------
A0A2K5MJY6_BMF-01       ASPSQGVMLPCGV-------------------------------------
G7PAW6_BMF-01           ASPSQGVMLPCGV-------------------------------------
A0A2K6B5G4_BMF-03       ASPSQGVMLPCGV-------------------------------------
A0A2K5Z4C3_BMF-02       ASPSQGVMLPCGV-------------------------------------
A0A096NTE9_BMF-03       ASPSQGVMLPCGV-------------------------------------
A0A2I3HD83_BMF-01       ASPSQGVMLPCGV-------------------------------------
A0A1S3EQA2_BMF-01       ASPSQGVMLPCGV-------------------------------------
Q8K589_BMF-01           ASPSQGVMLPCGV-------------------------------------
A2AV74_BMF-01           ASPSQGVMLPCGV-------------------------------------
I3MDS9_BMF-01           ASPSQGVMLPCGV-------------------------------------
G3T7Z4_BMF-01           ASPSQGVMLPCGV-------------------------------------
F6X3N6_BMF-01           ASPSQGVMLPCGV-------------------------------------
G3WDQ2_BMF-01           ASPSQGVMLPCGV-------------------------------------
A0A1S3WU31_BMF-01       ASPSQGVMLPCGV-------------------------------------
Q96LC9_BMF-06           ASPSQGVMLPCGV-------------------------------------
A0A286XXB0_BMF-02       SSPSQGVMLPCGV-------------------------------------
J9PB65_BMF-01           ASPSQGVMLPCGV-------------------------------------
A0A1U8CPE0_BMF-01       ASPSQGVMLPCGV-------------------------------------
A0A286XXB0_BMF-01       SSPSQGVMLPCGV-------------------------------------
G1SR62_BMF-01           ASPSQGVMLPCGV-------------------------------------
F6TJI0_BMF-01           ASPSQGVMLPCGV-------------------------------------
Q05KI3_BMF-01           ASPSQGVMLPCGV-------------------------------------
W5QFV1_BMF-01           ASPSQGVMLPCGV-------------------------------------
M3WRS0_BMF-01           ASPSQGVMLPCGV-------------------------------------
M3YAD5_BMF-01           ASPSQGVMLPCGV-------------------------------------
A0A2K6FFR1_BMF-01       ASPSQGVMLPCGV-------------------------------------
H0WYH6_BMF-01           ASPSQGVMLPCGV-------------------------------------
A0A096NTE9_BMF-01       ASPSQGVMLPCGV-------------------------------------
A0A2K6L933_BMF-02       ASPSQGVMLPCGV-------------------------------------
A0A096NTE9_BMF-02       ASPSQGVMLPCGV-------------------------------------
A0A2K5MJY6_BMF-02       ASPSQGVMLPCGV-------------------------------------
A0A2K5KGR6_BMF-02       ASPSQGVMLPCGV-------------------------------------
G7PAW6_BMF-02           ASPSQGVMLPCGV-------------------------------------
F7CM09_BMF-02           ASPSQGVMLPCGV-------------------------------------
A0A2K6B5G4_BMF-02       ASPSQGVMLPCGV-------------------------------------
A0A2K6B5G4_BMF-01       ASPSQGVMLPCGV-------------------------------------
A0A2K6B5G4_BMF-04       ASPSQGVMLPCGV-------------------------------------
A0A2K5Z4C3_BMF-01       ASPSQGVMLPCGV-------------------------------------
A0A2K6L933_BMF-03       ASPSQGVMLPCGV-------------------------------------
A0A2K6L933_BMF-01       ASPSQGVMLPCGV-------------------------------------
A0A2K6RAW8_BMF-01       ASPSQGVMLPCGV-------------------------------------
A0A0D9R4R5_BMF-01       ASPSQGVMLPCGV-------------------------------------
F7HPK0_BMF-01           ASPSQGVMLPCGV-------------------------------------
A0A2K5E1W9_BMF-01       ASPSQGVMLPCGV-------------------------------------
A0A2K6TW86_BMF-02       ASPSQGVMLPCGV-------------------------------------
A0A2K6TW86_BMF-01       ASPSQGVMLPCGV-------------------------------------
G3QIN5_BMF-01           ASPSQGVMLPCGV-------------------------------------
Q96LC9_BMF-01           ASPSQGVMLPCGV-------------------------------------
Q96LC9_BMF-02           ASPSQGVMLPCGV-------------------------------------
Q96LC9_BMF-03           ASPSQGVMLPCGV-------------------------------------
Q96LC9_BMF-04           ASPSQGVMLPCGV-------------------------------------
A0A2R9BS98_BMF-01       ASPSQGVMLPCGV-------------------------------------
A0A2J8QDD5_BMF-02       ASPSQGVMLPCGV-------------------------------------
A0A2J8T301_BMF-01       ASPSQGVMLPCGV-------------------------------------
H9GL49_BMF-01           SSSSQDVMLPCGV-------------------------------------
A9XRG9_BMF-01           SSSSQDVMLPCGV-------------------------------------
K7FRX2_BMF-01           SSSTQDVMLPCGV-------------------------------------
U3JS06_BMF-01           SSSSQDVMLPCGV-------------------------------------
H0ZMX5_BMF-01           SSSSQDVMLPCGV-------------------------------------
A9XRG9_BMF-02           SSSSQDVMLPCGV-------------------------------------
A9XRG9_BMF-03           SSSSQDVMLPCGV-------------------------------------
G1NHG8_BMF-01           SSSSQDVMLPCGV-------------------------------------
W5N4P7_BMF-01           ALVHGDNMLPCGV-------------------------------------
I3K2D6_BMF-01           ALVPNNGMLPCGV-------------------------------------
A0A096LRV0_BMF-01       GQALHNGMLPCGV-------------------------------------
A0A2U9CJH3_BMF-01       ALALNNGMLPCGV-------------------------------------
Q0GKC7_BMF-01           DVVLRQN----VS-------------------------------------
A0A2K5JY52_PMAIP1-      ------S----RV-------------------------------------
A0A096MPU8_PMAIP1-      ------S----RV-------------------------------------
A0A2K5ZWH1_PMAIP1-      ------S----RV-------------------------------------
A0A2K5VPX2_PMAIP1-      ------S----RV-------------------------------------
A0A2K6BV75_PMAIP1-      ------S----RV-------------------------------------
A0A2K6KJF2_PMAIP1-      ------S----RV-------------------------------------
A0A2K6NC45_PMAIP1-      ------S----RV-------------------------------------
Q13794_PMAIP1-02        ------S----RV-------------------------------------
A0A2R9AKC9_PMAIP1-      ------S----RV-------------------------------------
A0A1D5QGJ8_PMAIP1-      ------S----RV-------------------------------------
A0A2I2YVQ5_PMAIP1-      ------S----RV-------------------------------------
A0A2I3SX38_PMAIP1-      ------S----RV-------------------------------------
C1C3S9_BAD-01           RMSDEFD----QI-------------------------------------
F6Z067_BAD-01           EFEKSFT----GL-------------------------------------
M3XHJ5_BCL2L11-01       TSSSGYF----TF-------------------------------------
W5QCU2_BIK-01           SFMVAFT----NL-------------------------------------
O70337_BIK-04           SLIRSLT----NL-------------------------------------
O70337_BIK-02           SLIRSLT----NL-------------------------------------
O70337_BIK-01           SLIRSLT----NL-------------------------------------
Q925D2_BIK-01           SLIGSLT----NL-------------------------------------
G1TZR9_BIK-01           SVGLHLA----SL-------------------------------------
F1PUF4_BIK-01           SFLDGLA----NL-------------------------------------
H0XAE7_BIK-01           SVISGFT----NL-------------------------------------
A0A2K6FM79_BIK-01       SLSDGFA----NL-------------------------------------
A0A1S3FUQ7_BIK-01       RLIRGVA----HL-------------------------------------
H0W025_BIK-01           RLTLSLA----SL-------------------------------------
A0A2K5CLG5_BIK-01       GIVEVFA----NF-------------------------------------
F7FUT7_BIK-01           GVVDVFA----NF-------------------------------------
A0A2K6TBD7_BIK-01       GVVDVFA----DF-------------------------------------
H2P4N6_BIK-01           SFTDGFT----TL-------------------------------------
G1S1X2_BIK-01           SFMDGFT----TF-------------------------------------
G3QCT2_BIK-01           SFMDGFT----TL-------------------------------------
A0A2R8ZXD2_BIK-01       SFMDGFT----TL-------------------------------------
H2QLU7_BIK-01           SFMDGFT----TL-------------------------------------
Q13323_BIK-01           SFMDGFT----TL-------------------------------------
A0A2K6MCW0_BIK-01       SFMDGFT----TL-------------------------------------
A0A2K6QK74_BIK-01       SFMDGFT----TL-------------------------------------
A0A0D9QZY8_BIK-01       SFIDGFT----TL-------------------------------------
A0A2K5VW94_BIK-01       SFMDGFT----TL-------------------------------------
A0A2K6DBJ4_BIK-01       SFMDGFT----TL-------------------------------------
A0A2K5J4Q7_BIK-01       SFMDGFT----TL-------------------------------------
A0A096NKG5_BIK-01       SFMDGFT----TL-------------------------------------
A0A2K5LDM6_BIK-01       SFMDGFT----TL-------------------------------------
A0A2K5XSA1_BIK-01       SFLDGFT----TL-------------------------------------
I3K7B6_BAD-01           VCTPTE--------------------------------------------
B5X1T1_BAD-01           EEGGGD--------------------------------------------
Q4V925_BAD-02           TGVAEDP----HM-------------------------------------
Q4V925_BAD-03           TGVAEDP----HM-------------------------------------
A7MCM4_BAD-01           TGVAEDP----HM-------------------------------------
Q4V925_BAD-04           TGVAEDP----HM-------------------------------------
Q4V925_BAD-01           TGVAEDP----HM-------------------------------------
G3Q8B3_BAD-01           TGTPTE--------------------------------------------
A0A087X8P8_BAD-01       VGTPTE--------------------------------------------
E7FBJ6_BAD-01           GASVEEN----GD-------------------------------------
B5XEF1_BAD-01           TPTEEGG----GD-------------------------------------
G1SS60_BAD-01           ADADDSE----GA-------------------------------------
Q9GL49_PMAIP1-01        PRAACYL----QS-------------------------------------
H3D8J8_BAD-01           QGNGDDE----AG-------------------------------------
H3ANP3_BAD-03           SESQISD----SE-------------------------------------
H3ANP3_BAD-04           SESQISD----SE-------------------------------------
H3ANP3_BAD-01           SESQISD----SE-------------------------------------
H3ANP3_BAD-02           SESQISD----SE-------------------------------------
A0A337SAW2_BAD-01       AGTEEDE----GT-------------------------------------
A0A2U9BAC9_BAD-01       TRWDEEA----GT-------------------------------------
A0A2I3TBK7_BAD-01       AAKLQLD----AS-------------------------------------
A0A2R8Z697_BAD-02       AAKLQLD----AS-------------------------------------
A0A2I2Z8C7_BAD-03       AAKLQLD----AS-------------------------------------
Q92934_BAD-03           AAKLQLD----AS-------------------------------------
A0A2K5M0C1_BAD-02       AAKLQLD----AS-------------------------------------
A0A2K5XJR2_BAD-02       AAKLQLD----AS-------------------------------------
A0A2I3MCN5_BAD-03       AAKLQLD----AS-------------------------------------
A0A2K5VCD8_BAD-02       AAKLQLD----AS-------------------------------------
F7GVS7_BAD-02           AAKLQLD----AS-------------------------------------
A0A2K6E7J3_BAD-02       AAKLQLD----AS-------------------------------------
A0A2K5E6K7_BAD-02       AAKLQLD----AS-------------------------------------
A0A2K6TG62_BAD-02       AAKLQLD----AS-------------------------------------
A0A2K5E6K7_BAD-03       SARMLSK----AS-------------------------------------
A0A2K5HKW9_BAD-02       SARMLTE----AS-------------------------------------
A0A2K6N1A1_BAD-02       SARMLAE----AS-------------------------------------
A0A2K6PUM5_BAD-02       SARMLAE----AS-------------------------------------
A0A2K5M0C1_BAD-03       SARMLAE----AS-------------------------------------
A0A2K5VCD8_BAD-03       SARMLAE----AS-------------------------------------
F7GVS7_BAD-03           SARMLAE----AS-------------------------------------
A0A2K5XJR2_BAD-03       SARMLAE----AS-------------------------------------
A0A2I3MCN5_BAD-02       SARMLAE----AS-------------------------------------
A0A2K6E7J3_BAD-03       SARMLAE----AS-------------------------------------
A0A2I2Z8C7_BAD-04       SAGMLAE----AS-------------------------------------
Q92934_BAD-04           SAGMLAE----AS-------------------------------------
A0A2I3TBK7_BAD-03       SAGMLAE----AS-------------------------------------
A0A2R8Z697_BAD-03       SAGMLAE----AS-------------------------------------
F6SJL0_BAD-02           SVRMFSK----AS-------------------------------------
A0A2K6TG62_BAD-03       SAKMLSK----AS-------------------------------------
G1P8C5_BAD-01           TGTEEDD----DT-------------------------------------
W5P8G9_BAD-01           AGPEDDE----GT-------------------------------------
G3VRY4_BAD-01           AEAEAEQ----SE-------------------------------------
G3VRY4_BAD-02           AEAEAEQ----SE-------------------------------------
G3TP47_BAD-01           AGSDEAE----GL-------------------------------------
I3MBM5_BAD-01           ADTDLDE----GM-------------------------------------
I3MBM5_BAD-02           ADTDLDE----GM-------------------------------------
A0A091DDU4_BAD-01       TGTEEEE----GM-------------------------------------
Q61337_BAD-02           AGTEEDE----GM-------------------------------------
Q61337_BAD-03           AGTEEDE----GM-------------------------------------
A0A1U7Q4V0_BAD-01       AGNEEDE----GM-------------------------------------
Q61337_BAD-01           AGTEEDE----GM-------------------------------------
G1MI17_BAD-01           AGTEEDE----GL-------------------------------------
A0A287AEF3_BAD-01       EGTEEDE----GT-------------------------------------
O35147_BAD-01           AGTEEDE----GM-------------------------------------
M3YNE7_BAD-01           AGTEEDE----GM-------------------------------------
F1MUT9_BAD-01           AGPEDNE----ET-------------------------------------
Q3SYZ0_BAD-01           AGPEDNE----ET-------------------------------------
F7DN67_BAD-01           EGTEDEG----ME-------------------------------------
H0WVR2_BAD-01           AGTEEDE----GI-------------------------------------
H0V608_BAD-01           AGTEEEE----GM-------------------------------------
A0A1S3FL84_BAD-01       AGMEEDE----GL-------------------------------------
A0A2K5E6K7_BAD-01       AGTEEDE----GM-------------------------------------
A0A2K6TG62_BAD-01       AGTEGDE----GM-------------------------------------
A0A0D9R491_BAD-01       AGTEEDE----GM-------------------------------------
A0A2K5M0C1_BAD-01       AGTEEDE----GM-------------------------------------
A0A2K5VCD8_BAD-01       AGTEEDE----GM-------------------------------------
F7GVS7_BAD-01           AGTEEDE----GM-------------------------------------
A0A2K6E7J3_BAD-01       AGTEEDE----GM-------------------------------------
A0A2K5XJR2_BAD-01       AGTEEDE----GM-------------------------------------
A0A2I3MCN5_BAD-04       AGTEEDE----GM-------------------------------------
A0A2K6N1A1_BAD-01       AGTEEDE----GM-------------------------------------
A0A2K6PUM5_BAD-01       AGTEEDE----GM-------------------------------------
A0A2K5HKW9_BAD-01       AGTEEDE----GM-------------------------------------
B4DZQ9_BAD-01           AGTEDDE----GM-------------------------------------
A0A2K6GWV0_BAD-01       AGTEEDE----GM-------------------------------------
F6SJL0_BAD-01           AGTEEDE----GM-------------------------------------
A0A2I3MCN5_BAD-01       AGTEEDE----GM-------------------------------------
A0A2I2Z8C7_BAD-01       AGTEDDE----GM-------------------------------------
A0A2I2Z8C7_BAD-02       AGTEDDE----GM-------------------------------------
Q92934_BAD-01           AGTEDDE----GM-------------------------------------
Q92934_BAD-02           AGTEDDE----GM-------------------------------------
A0A2I3TBK7_BAD-02       AGTEDDE----GM-------------------------------------
A0A2R8Z697_BAD-01       AGTEDDE----GM-------------------------------------
A0A2J8TYJ3_BAD-01       AGTEDDE----GM-------------------------------------
F1PK10_BAD-01           AGTDEDE----GM-------------------------------------
Q45KI9_BAD-01           AGTDEDE----GM-------------------------------------
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          GLGKLRRGRARGVAPPLTCSAHLSVSLRRLPPHWGMARAQQDGSSPEPVE
F6RS78_BIK-01           ----------------------------------------GDNRDSVAMR
B2KKY9_BCL2L11-01       ----------------------------------------PNISEAQDGQ
B8JK68_BCL2L11-01       ----------------------------------------PNISEAQDGQ
A0A2K6KS56_BBC3-02      ----------------------------------------EQQRHRPSPW
F7G1G0_HRK-01           ----------------------------------------RRARSRRAAA
A0A1U7R468_HRK-01       ----------------------------------------RRARP-RDPL
P62816_HRK-03           ----------------------------------------RRARP-RDPL
P62817_HRK-01           ----------------------------------------RRARP-RDPL
A0A287A5N9_HRK-01       ----------------------------------------RSARSRRAPA
H2NIS8_HRK-01           ----------------------------------------RRARSRRAPA
A0A2K5KZ69_HRK-01       ----------------------------------------RRARSRRAPA
H2Q6Y8_HRK-01           ----------------------------------------RRARSRRAPA
G3UH24_HRK-01           ----------------------------------------RRARSRRAPA
A0A2K5BYA0_HRK-01       ----------------------------------------RRARSRRAPA
G3MWR6_HRK-01           ----------------------------------------RRARSRRAPA
U3E722_HRK-01           ----------------------------------------RRARSRRAPA
A0A0D9SC73_HRK-01       ----------------------------------------RRARSRRAPA
A0A337SQ56_HRK-01       ----------------------------------------RRARSRRAPA
G3QTJ6_HRK-01           ----------------------------------------RRARSRRAPA
O00198_HRK-01           ----------------------------------------RRARSRRAPA
A0A1D5R1E4_HRK-01       ----------------------------------------RRARSRRAPA
A0A2K6AYL7_HRK-01       ----------------------------------------RRARSRRAPA
G1QHD8_HRK-01           ----------------------------------------RRARSRRAPA
G1T7W1_HRK-01           ----------------------------------------RRARSRRAPA
H0Y001_HRK-01           ----------------------------------------RRARSRRAPA
A0A096N944_HRK-01       ----------------------------------------RRARSRRAPA
A0A2K6GL98_HRK-01       ----------------------------------------RRARSRRAPA
E2RLD4_HRK-01           ----------------------------------------RRARSRRAPA
F7GVS7_BAD-04           ----------------------------------------RAGLSLPCPK
Q2PG01_BAD-01           ----------------------------------------SAGTATQMRQ
A0A2I3H4B2_BAD-01       ----------------------------------------SAGTATQMRQ
K7GA86_BCL2L11-01       ----------------------------------------DKSTQTPSPP
G3SU55_BCL2L11-01       ----------------------------------------DKSTQTPSPP
G3W979_BCL2L11-01       ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-11       ----------------------------------------------VSLC
F7HHA9_BCL2L11-08       ----------------------------------------------VSLC
A0A1U8BW10_BCL2L11      ----------------------------------------DKSTQTPSPP
O54918_BCL2L11-03       ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-19       ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-07       ----------------------------------------DKSTQTPSPP
A0A2I3HW02_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6TRZ5_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5HZI7_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5NU92_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5Z8B6_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I2YQ13_BCL2L11      ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-23       ----------------------------------------DKSTQTPSPP
A0A2R9CA99_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2J8JCT2_BCL2L11      ----------------------------------------DKSTQTPSPP
F7HHA9_BCL2L11-07       ----------------------------------------DKSTQTPSPP
A0A2K5CAB2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5X2I7_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I3M6I1_BCL2L11      ----------------------------------------DKSTQTPSPP
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5Z8B6_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6KJP8_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6QIL2_BCL2L11      ----------------------------------------DKSTQTPSPP
F6XMC1_BCL2L11-09       ----------------------------------------DKSTQTPSPP
A0A2K6TRZ5_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5HZI7_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2R9CA99_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2J8JCT2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5NU92_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5X2I7_BCL2L11      ----------------------------------------DKSTQTPSPP
F7HHA9_BCL2L11-09       ----------------------------------------DKSTQTPSPP
A0A2K6E226_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I3M6I1_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I2YQ13_BCL2L11      ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-06       ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-15       ----------------------------------------DKSTQTPSPP
A0A2I3HW02_BCL2L11      ----------------------------------------DKSTQTPSPP
F1SU81_BCL2L11-03       ----------------------------------------DKSTQTPSPP
A0A0D9RWE0_BCL2L11      ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-05       ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-25       ----------------------------------------DKSTQTPSPP
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
A0A1U8BW10_BCL2L11      ----------------------------------------DKSTQTPSPP
Q2YDF0_BCL2L11-01       ----------------------------------------DKSTQTPSPP
A0A287DFJ0_BCL2L11      ----------------------------------------DKSTQTPSPP
O54918_BCL2L11-05       ----------------------------------------DKSTQTPSPP
O88498_BCL2L11-02       ----------------------------------------DKSTQTPSPP
A0A2K6GE31_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5CAB2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6TRZ5_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6QIL2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5NU92_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5HZI7_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5X2I7_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6E226_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5Z8B6_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I3M6I1_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I3M6I1_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6KJP8_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I2YQ13_BCL2L11      ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-02       ----------------------------------------DKSTQTPSPP
A0A2R9CA99_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2J8JCT2_BCL2L11      ----------------------------------------DKSTQTPSPP
H2P5E2_BCL2L11-01       ----------------------------------------DKSTQTPSPP
A0A337SW42_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A286XJN2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A1S3FHA8_BCL2L11      ----------------------------------------DKSTQTPSPP
Q4KMV9_BCL2L11-01       ----------------------------------------DKSTQTPSPP
F7FTC8_BCL2L11-01       ----------------------------------------DKSTQTPSPH
A0A2K6E226_BCL2L11      ----------------------------------------DKSTQTPSPP
M3YDI3_BCL2L11-01       ----------------------------------------DKSTQTPSPP
F6XMC1_BCL2L11-02       ----------------------------------------DKSTQTPSPP
F6XMC1_BCL2L11-01       ----------------------------------------DKSTQTPSPP
F7CXT2_BCL2L11-01       ----------------------------------------DKSTQTPSPP
F6XMC1_BCL2L11-08       ----------------------------------------DKSTQTPSPP
A0A337SW42_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A337SW42_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6GE31_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6GE31_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5NU92_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5HZI7_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I2YQ13_BCL2L11      ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-08       ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-22       ----------------------------------------DKSTQTPSPP
A0A2K5X2I7_BCL2L11      ----------------------------------------DKSTQTPSPP
F7HHA9_BCL2L11-03       ----------------------------------------DKSTQTPSPP
A0A2K6E226_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5Z8B6_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I3HW02_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2R9CA99_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2J8JCT2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I3M6I1_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6KJP8_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6QIL2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5CAB2_BCL2L11      ----------------------------------------DKSTQTPSPP
F6XMC1_BCL2L11-06       ----------------------------------------DKSTQTPSPP
A0A2K6TRZ5_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5CAB2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6TRZ5_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5CAB2_BCL2L11      ----------------------------------------DKSTQTPSPP
F6XMC1_BCL2L11-04       ----------------------------------------DKSTQTPSPP
A0A2K6TRZ5_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5NU92_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I2YQ13_BCL2L11      ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-21       ----------------------------------------DKSTQTPSPP
A0A2K5X2I7_BCL2L11      ----------------------------------------DKSTQTPSPP
F7HHA9_BCL2L11-01       ----------------------------------------DKSTQTPSPP
A0A2K6E226_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5Z8B6_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I3HW02_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2R9CA99_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2J8JCT2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I3M6I1_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6KJP8_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6QIL2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5NU92_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5HZI7_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I2YQ13_BCL2L11      ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-24       ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-12       ----------------------------------------DKSTQTPSPP
A0A2K5X2I7_BCL2L11      ----------------------------------------DKSTQTPSPP
F7HHA9_BCL2L11-06       ----------------------------------------DKSTQTPSPP
A0A2K6E226_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5Z8B6_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I3HW02_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2R9CA99_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2J8JCT2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I3M6I1_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6KJP8_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6QIL2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5HZI7_BCL2L11      ----------------------------------------DKSTQTPSPP
O54918_BCL2L11-01       ----------------------------------------DKSTQTPSPP
O88498_BCL2L11-01       ----------------------------------------DKSTQTPSPP
A0A1U8BW10_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A287DFJ0_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6GE31_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6GE31_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5CAB2_BCL2L11      ----------------------------------------DKSTQTPSPP
F6XMC1_BCL2L11-07       ----------------------------------------DKSTQTPSPP
A0A2K6TRZ5_BCL2L11      ----------------------------------------DKSTQTPSPP
F6XMC1_BCL2L11-05       ----------------------------------------DKSTQTPSPP
A0A2K6TRZ5_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5CAB2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5NU92_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5HZI7_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5X2I7_BCL2L11      ----------------------------------------DKSTQTPSPP
F7HHA9_BCL2L11-02       ----------------------------------------DKSTQTPSPP
A0A2K6E226_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5Z8B6_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I3M6I1_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6KJP8_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6QIL2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I2YQ13_BCL2L11      ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-16       ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-09       ----------------------------------------DKSTQTPSPP
A0A2R9CA99_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2J8JCT2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5NU92_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5HZI7_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5X2I7_BCL2L11      ----------------------------------------DKSTQTPSPP
F7HHA9_BCL2L11-04       ----------------------------------------DKSTQTPSPP
A0A2K6E226_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5Z8B6_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I3M6I1_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6KJP8_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6QIL2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I2YQ13_BCL2L11      ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-18       ----------------------------------------DKSTQTPSPP
A0A2I3HW02_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2R9CA99_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2J8JCT2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5CAB2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5CAB2_BCL2L11      ----------------------------------------DKSTQTPSPP
F6XMC1_BCL2L11-03       ----------------------------------------DKSTQTPSPP
A0A2K6TRZ5_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6TRZ5_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6QIL2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6QIL2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5NU92_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5HZI7_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5X2I7_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6E226_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6E226_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K5Z8B6_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I3M6I1_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6KJP8_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2K6KJP8_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2I2YQ13_BCL2L11      ----------------------------------------DKSTQTPSPP
O43521_BCL2L11-03       ----------------------------------------DKSTQTPSPP
A0A2I3HW02_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2R9CA99_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A2J8JCT2_BCL2L11      ----------------------------------------DKSTQTPSPP
F1SU81_BCL2L11-02       ----------------------------------------DKSTQTPSPP
A0A337SW42_BCL2L11      ----------------------------------------DKSTQTPSPP
W5PY58_BCL2L11-01       ----------------------------------------DKSTQTPSPP
F7A7D2_BCL2L11-01       ----------------------------------------DKSTQTPSPP
A0A286XJN2_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A286XJN2_BCL2L11      ----------------------------------------DKSTQTPSPP
G1SSY0_BCL2L11-01       ----------------------------------------DKSTQTPSPP
H0XW23_BCL2L11-01       ----------------------------------------DKSTQTPSPP
A0A1S3FHA8_BCL2L11      ----------------------------------------DKSTQTPSPP
A0A337SW42_BCL2L11      ----------------------------------------DKSTQTPSPP
G1LDR8_BCL2L11-01       ----------------------------------------DKSTQTPSPP
J9NWV6_BCL2L11-01       ----------------------------------------DKSTQTPSPP
F1SU81_BCL2L11-01       ----------------------------------------DKSTQTPSPP
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A9XRH0_BMF-01           -----------------------------------------EEPQEGQRE
R4G9R5_BCL2L11-01       ----------------------------------------EDMQP-----
Q6P7C5_BAD-01           ----------------------------------------LSHVP-----
A0A287AEF3_BAD-02       ----------------------------------------RSSAPSAADR
O61667_EGL1-01          -----------------------------------------FADDSGFFD
A3KND0_BMF-01           -----------------------------------------SETPQRLFY
A0A2K5F6X4_BBC3-02      -----------------------------------------PSAPGALAG
A0A337SQV0_BBC3-03      -----------------------------------------PSAPGALAG
F1SMU1_PMAIP1-01        -----------------------------------------AEMPGRRSR
Q9BXH1_BBC3-04          -----------------------------------------RPVDVRDSG
K7E5Y2_BBC3-02          ----------------------------------------EPQGASPMSG
F7CQN5_BBC3-01          -----------------------------------------PSAPGALEG
A0A2I3HWI8_BBC3-03      ------------------------------------------------AG
A0A2K6FQZ3_BBC3-04      -----------------------------------------PSAPGALAG
Q9BXH1_BBC3-05          -----------------------------------------PSAPGALAG
A0A2R9BZA9_BBC3-01      -----------------------------------------PSAPGALAG
A0A2I3RGH5_BBC3-03      -----------------------------------------PSAPGALAG
A0A2K5P2T8_BBC3-03      -----------------------------------------PSAPGALAG
A0A2K5V8J3_BBC3-03      -----------------------------------------PSAPGALAG
F7FFP6_BBC3-03          -----------------------------------------PSAPGALAG
A0A2K6ASP2_BBC3-03      -----------------------------------------PSAPGALAG
A0A2I3N2Z9_BBC3-03      -----------------------------------------PSAPGALAG
A0A2K6QZU4_BBC3-04      -----------------------------------------PSAPGALAG
A0A2R8MW85_BBC3-03      -----------------------------------------PSAPGALAG
A0A2K6STD6_BBC3-02      -----------------------------------------PSAPGALAG
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          -----------------------------------------PSAPGALAG
A0A1U7R5N5_BBC3-01      -----------------------------------------PSAPEALAG
Q99ML1_BBC3-02          -----------------------------------------PSAPEALAG
Q80ZG6_BBC3-01          -----------------------------------------PSAPEALAG
H0XQ00_BBC3-01          -----------------------------------------PSTPGALAG
J9NTK9_BBC3-01          -----------------------------------------PSAPGALAG
A0A337SQV0_BBC3-02      -----------------------------------------PSAPGALAG
F1RM01_BBC3-01          -----------------------------------------PSAPGALAG
A0A2K6FQZ3_BBC3-01      -----------------------------------------PSAPGALAG
Q9BXH1_BBC3-06          -----------------------------------------PSAPGALAG
A0A2I3RIG5_BBC3-02      -----------------------------------------PSAPGALAG
H2NZD3_BBC3-01          -----------------------------------------PSAPGALAG
A0A2K6QZU4_BBC3-01      -----------------------------------------PSAPGALAG
A0A0D9S2H2_BBC3-01      -----------------------------------------PSAPGALAG
B4DQK3_BBC3-01          -----------------------------------------PSAPGALAG
F6TGJ4_BMF-01           -----------------------------------------SETPQRLFY
G1PAU1_BMF-01           -----------------------------------------TEEPQRLFY
A0A1U8CPE0_BMF-02       -----------------------------------------TEEPQRLFY
A0A286XXB0_BMF-03       -----------------------------------------TEEPQRLFY
I3MDS9_BMF-02           -----------------------------------------TEEPQRLFY
A0A287AIU8_BMF-05       -----------------------------------------TEEPQRLFY
A0A287AIU8_BMF-03       -----------------------------------------TEEPQRLFY
A0A287AIU8_BMF-01       -----------------------------------------TEEPQRLFY
A0A287AIU8_BMF-02       -----------------------------------------TEEPQRLFY
A0A287AIU8_BMF-04       -----------------------------------------TEEPQRLFY
A0A1S3EQA2_BMF-02       -----------------------------------------TEEPQRLFY
A2AV74_BMF-02           -----------------------------------------TEEPQRLFY
A0A337SQV0_BBC3-01      -----------------------------------------LGRVLRPLR
Q9BXH1_BBC3-03          -----------------------------------------LGSVLRPLR
A0A2K5KGR6_BMF-01       -----------------------------------------TEEPQRLFY
A0A2K6FFR1_BMF-02       -----------------------------------------TEEPQRLFY
M3WRS0_BMF-02           -----------------------------------------TEEPQRLFY
A0A2K5E1W9_BMF-02       -----------------------------------------TEEPQRLFY
F7HPK0_BMF-02           -----------------------------------------TEEPQRLFY
A0A2K6TW86_BMF-03       -----------------------------------------TEEPQRLFY
A0A2K6RAW8_BMF-02       -----------------------------------------TEEPQRLFY
G3QIN5_BMF-02           -----------------------------------------TEEPQRLFY
Q96LC9_BMF-07           -----------------------------------------TEEPQRLFY
Q96LC9_BMF-05           -----------------------------------------TEEPQRLFY
A0A2R9BS98_BMF-02       -----------------------------------------TEEPQRLFY
A0A2J8QDD5_BMF-01       -----------------------------------------TEEPQRLFY
A0A2K5MJY6_BMF-01       -----------------------------------------TEEPQRLFY
G7PAW6_BMF-01           -----------------------------------------TEEPQRLFY
A0A2K6B5G4_BMF-03       -----------------------------------------TEEPQRLFY
A0A2K5Z4C3_BMF-02       -----------------------------------------TEEPQRLFY
A0A096NTE9_BMF-03       -----------------------------------------TEEPQRLFY
A0A2I3HD83_BMF-01       -----------------------------------------TEEPQRLFY
A0A1S3EQA2_BMF-01       -----------------------------------------TEEPQRLFY
Q8K589_BMF-01           -----------------------------------------TEEPQRLFY
A2AV74_BMF-01           -----------------------------------------TEEPQRLFY
I3MDS9_BMF-01           -----------------------------------------TEEPQRLFY
G3T7Z4_BMF-01           -----------------------------------------TEEPQRLFY
F6X3N6_BMF-01           -----------------------------------------TEEPHRLFY
G3WDQ2_BMF-01           -----------------------------------------TEEPHRLFY
A0A1S3WU31_BMF-01       -----------------------------------------TEEPQRLFY
Q96LC9_BMF-06           -----------------------------------------TEEPQRLFY
A0A286XXB0_BMF-02       -----------------------------------------TEEPQRLFY
J9PB65_BMF-01           -----------------------------------------TEEPQRLFY
A0A1U8CPE0_BMF-01       -----------------------------------------TEEPQRLFY
A0A286XXB0_BMF-01       -----------------------------------------TEEPQRLFY
G1SR62_BMF-01           -----------------------------------------TEEPQRLFY
F6TJI0_BMF-01           -----------------------------------------TEEPQRLFY
Q05KI3_BMF-01           -----------------------------------------TEEPQRLFY
W5QFV1_BMF-01           -----------------------------------------TEEPQRLFY
M3WRS0_BMF-01           -----------------------------------------TEEPQRLFY
M3YAD5_BMF-01           -----------------------------------------TEEPQRLFY
A0A2K6FFR1_BMF-01       -----------------------------------------TEEPQRLFY
H0WYH6_BMF-01           -----------------------------------------TEEPQRLFY
A0A096NTE9_BMF-01       -----------------------------------------TEEPQRLFY
A0A2K6L933_BMF-02       -----------------------------------------TEEPQRLFY
A0A096NTE9_BMF-02       -----------------------------------------TEEPQRLFY
A0A2K5MJY6_BMF-02       -----------------------------------------TEEPQRLFY
A0A2K5KGR6_BMF-02       -----------------------------------------TEEPQRLFY
G7PAW6_BMF-02           -----------------------------------------TEEPQRLFY
F7CM09_BMF-02           -----------------------------------------TEEPQRLFY
A0A2K6B5G4_BMF-02       -----------------------------------------TEEPQRLFY
A0A2K6B5G4_BMF-01       -----------------------------------------TEEPQRLFY
A0A2K6B5G4_BMF-04       -----------------------------------------TEEPQRLFY
A0A2K5Z4C3_BMF-01       -----------------------------------------TEEPQRLFY
A0A2K6L933_BMF-03       -----------------------------------------TEEPQRLFY
A0A2K6L933_BMF-01       -----------------------------------------TEEPQRLFY
A0A2K6RAW8_BMF-01       -----------------------------------------TEEPQRLFY
A0A0D9R4R5_BMF-01       -----------------------------------------TEEPQRLFY
F7HPK0_BMF-01           -----------------------------------------TEEPQRLFY
A0A2K5E1W9_BMF-01       -----------------------------------------TEEPQRLFY
A0A2K6TW86_BMF-02       -----------------------------------------TEEPQRLFY
A0A2K6TW86_BMF-01       -----------------------------------------TEEPQRLFY
G3QIN5_BMF-01           -----------------------------------------TEEPQRLFY
Q96LC9_BMF-01           -----------------------------------------TEEPQRLFY
Q96LC9_BMF-02           -----------------------------------------TEEPQRLFY
Q96LC9_BMF-03           -----------------------------------------TEEPQRLFY
Q96LC9_BMF-04           -----------------------------------------TEEPQRLFY
A0A2R9BS98_BMF-01       -----------------------------------------TEEPQRLFY
A0A2J8QDD5_BMF-02       -----------------------------------------TEEPQRLFY
A0A2J8T301_BMF-01       -----------------------------------------TEEPQRLFY
H9GL49_BMF-01           -----------------------------------------TEEPQRLFY
A9XRG9_BMF-01           -----------------------------------------TEEPRRLFY
K7FRX2_BMF-01           -----------------------------------------TEEPQRLFY
U3JS06_BMF-01           -----------------------------------------TEEPRRLFY
H0ZMX5_BMF-01           -----------------------------------------TEEPRRLFY
A9XRG9_BMF-02           -----------------------------------------TEEPRRLFY
A9XRG9_BMF-03           -----------------------------------------TEEPRRLFY
G1NHG8_BMF-01           -----------------------------------------TEEPRRLFY
W5N4P7_BMF-01           -----------------------------------------GAEPRRLFY
I3K2D6_BMF-01           -----------------------------------------AEEPRPLFY
A0A096LRV0_BMF-01       -----------------------------------------AEEPRRLFY
A0A2U9CJH3_BMF-01       -----------------------------------------AEEPRPLFY
Q0GKC7_BMF-01           -----------------------------------------PMER-----
A0A2K5JY52_PMAIP1-      -----------------------------------------CYSTQEIWR
A0A096MPU8_PMAIP1-      -----------------------------------------CYSTQEIWR
A0A2K5ZWH1_PMAIP1-      -----------------------------------------CYSTQEIWR
A0A2K5VPX2_PMAIP1-      -----------------------------------------CYSTQEIWR
A0A2K6BV75_PMAIP1-      -----------------------------------------CYSTQEIWR
A0A2K6KJF2_PMAIP1-      -----------------------------------------CYSTQEIWR
A0A2K6NC45_PMAIP1-      -----------------------------------------CYSTQEIWR
Q13794_PMAIP1-02        -----------------------------------------CYSTQEIWR
A0A2R9AKC9_PMAIP1-      -----------------------------------------CYSTQEIWR
A0A1D5QGJ8_PMAIP1-      -----------------------------------------CYSTQEIWR
A0A2I2YVQ5_PMAIP1-      -----------------------------------------CYSTQEIWR
A0A2I3SX38_PMAIP1-      -----------------------------------------CYSTQEIWR
C1C3S9_BAD-01           -----------------------------------------FTSI-----
F6Z067_BAD-01           --------------------------------------------------
M3XHJ5_BCL2L11-01       -----------------------------------------DSDIVHS--
W5QCU2_BIK-01           -----------------------------------------RENR-RLWS
O70337_BIK-04           -----------------------------------------RENIWS-WR
O70337_BIK-02           -----------------------------------------RENIWS-WR
O70337_BIK-01           -----------------------------------------RENIWS-WR
Q925D2_BIK-01           -----------------------------------------RENIWS-WR
G1TZR9_BIK-01           -----------------------------------------VE----LWS
F1PUF4_BIK-01           -----------------------------------------RENI-RIWS
H0XAE7_BIK-01           -----------------------------------------RENIAGFWR
A0A2K6FM79_BIK-01       -----------------------------------------REYVARLWR
A0A1S3FUQ7_BIK-01       -----------------------------------------RAHI-RAWR
H0W025_BIK-01           -----------------------------------------RDNV---WA
A0A2K5CLG5_BIK-01       -----------------------------------------QEDIVRLWR
F7FUT7_BIK-01           -----------------------------------------QEDIVRLWR
A0A2K6TBD7_BIK-01       -----------------------------------------QEDIVRLWR
H2P4N6_BIK-01           -----------------------------------------KENIMRFWS
G1S1X2_BIK-01           -----------------------------------------KENIIRLWR
G3QCT2_BIK-01           -----------------------------------------KENIMRFWR
A0A2R8ZXD2_BIK-01       -----------------------------------------KENIMRFWR
H2QLU7_BIK-01           -----------------------------------------KENIMRFWR
Q13323_BIK-01           -----------------------------------------KENIMRFWR
A0A2K6MCW0_BIK-01       -----------------------------------------KENIMRFWR
A0A2K6QK74_BIK-01       -----------------------------------------KENIMRFWR
A0A0D9QZY8_BIK-01       -----------------------------------------RENIMRFWR
A0A2K5VW94_BIK-01       -----------------------------------------RENIMRFWR
A0A2K6DBJ4_BIK-01       -----------------------------------------RENIMRFWR
A0A2K5J4Q7_BIK-01       -----------------------------------------KENIMRFWR
A0A096NKG5_BIK-01       -----------------------------------------RENIMRFWR
A0A2K5LDM6_BIK-01       -----------------------------------------RENIMRFWR
A0A2K5XSA1_BIK-01       -----------------------------------------RENIMRFWR
I3K7B6_BAD-01           ------------------------------------------G---DPFR
B5X1T1_BAD-01           ------------------------------------------G---APFR
Q4V925_BAD-02           -----------------------------------------LG---DPFR
Q4V925_BAD-03           -----------------------------------------LG---DPFR
A7MCM4_BAD-01           -----------------------------------------LG---DPFR
Q4V925_BAD-04           -----------------------------------------LG---DPFR
Q4V925_BAD-01           -----------------------------------------LG---DPFR
G3Q8B3_BAD-01           ------------------------------------------G---APFR
A0A087X8P8_BAD-01       ------------------------------------------G---FPFR
E7FBJ6_BAD-01           -----------------------------------------G----LPFR
B5XEF1_BAD-01           -----------------------------------------G----ASFR
G1SS60_BAD-01           -----------------------------------------EEEP-SPFR
Q9GL49_PMAIP1-01        -----------------------------------------QGARVRGLS
H3D8J8_BAD-01           -----------------------------------------TPTDGAPFR
H3ANP3_BAD-03           -----------------------------------------SLDELGPFR
H3ANP3_BAD-04           -----------------------------------------SLDELGPFR
H3ANP3_BAD-01           -----------------------------------------SLDELGPFR
H3ANP3_BAD-02           -----------------------------------------SLDELGPFR
A0A337SAW2_BAD-01       -----------------------------------------EEEEPSPFR
A0A2U9BAC9_BAD-01       -----------------------------------------PTDG-APFR
A0A2I3TBK7_BAD-01       -----------------------------------------LPVLVGSEL
A0A2R8Z697_BAD-02       -----------------------------------------LPVLVGSEL
A0A2I2Z8C7_BAD-03       -----------------------------------------LPVLVGSEL
Q92934_BAD-03           -----------------------------------------LPVLVGSEL
A0A2K5M0C1_BAD-02       -----------------------------------------LPVLVGSEL
A0A2K5XJR2_BAD-02       -----------------------------------------LPVLVGSEL
A0A2I3MCN5_BAD-03       -----------------------------------------LPVLVGSEL
A0A2K5VCD8_BAD-02       -----------------------------------------LPVLVGSEL
F7GVS7_BAD-02           -----------------------------------------LPVLVGSEL
A0A2K6E7J3_BAD-02       -----------------------------------------LPVLVGSEL
A0A2K5E6K7_BAD-02       -----------------------------------------HPVLVGSEL
A0A2K6TG62_BAD-02       -----------------------------------------HPVLVGSEL
A0A2K5E6K7_BAD-03       -----------------------------------------AGMSAPATD
A0A2K5HKW9_BAD-02       -----------------------------------------AGMSAPATD
A0A2K6N1A1_BAD-02       -----------------------------------------AGMSAPATD
A0A2K6PUM5_BAD-02       -----------------------------------------AGMSAPATD
A0A2K5M0C1_BAD-03       -----------------------------------------ARMSAPATD
A0A2K5VCD8_BAD-03       -----------------------------------------ARMSAPATD
F7GVS7_BAD-03           -----------------------------------------ARMSAPATD
A0A2K5XJR2_BAD-03       -----------------------------------------ARMSAPATD
A0A2I3MCN5_BAD-02       -----------------------------------------APMSAPATD
A0A2K6E7J3_BAD-03       -----------------------------------------ARMSAPATD
A0A2I2Z8C7_BAD-04       -----------------------------------------AGMSAPAAD
Q92934_BAD-04           -----------------------------------------AGMSAPAAD
A0A2I3TBK7_BAD-03       -----------------------------------------AGMSAPAAD
A0A2R8Z697_BAD-03       -----------------------------------------AGMSAPAAD
F6SJL0_BAD-02           -----------------------------------------AGMSAPATD
A0A2K6TG62_BAD-03       -----------------------------------------AGMSAPATD
G1P8C5_BAD-01           -----------------------------------------EEGEPSPFR
W5P8G9_BAD-01           -----------------------------------------EEEDLGPFR
G3VRY4_BAD-01           -----------------------------------------GEEERGLFR
G3VRY4_BAD-02           -----------------------------------------GEEERGLFR
G3TP47_BAD-01           -----------------------------------------EEDP-SPFR
I3MBM5_BAD-01           -----------------------------------------EEEP-SPFR
I3MBM5_BAD-02           -----------------------------------------EEEP-SPFR
A0A091DDU4_BAD-01       -----------------------------------------EEEP-SPFR
Q61337_BAD-02           -----------------------------------------EEEL-SPFR
Q61337_BAD-03           -----------------------------------------EEEL-SPFR
A0A1U7Q4V0_BAD-01       -----------------------------------------EEEL-SPFR
Q61337_BAD-01           -----------------------------------------EEEL-SPFR
G1MI17_BAD-01           -----------------------------------------EEEELSPFR
A0A287AEF3_BAD-01       -----------------------------------------EDEELSPFR
O35147_BAD-01           -----------------------------------------EEEL-SPFR
M3YNE7_BAD-01           -----------------------------------------EEEELSPFR
F1MUT9_BAD-01           -----------------------------------------EEEDLGPFR
Q3SYZ0_BAD-01           -----------------------------------------EEEDLGPFR
F7DN67_BAD-01           -----------------------------------------GEEP-GPFR
H0WVR2_BAD-01           ------------------------------------------EEP-SPFR
H0V608_BAD-01           -----------------------------------------EEEL-SPFR
A0A1S3FL84_BAD-01       -----------------------------------------EEEP-SPFR
A0A2K5E6K7_BAD-01       -----------------------------------------EEEP-SPFR
A0A2K6TG62_BAD-01       -----------------------------------------EEEP-SPFR
A0A0D9R491_BAD-01       -----------------------------------------EEEP-SPFR
A0A2K5M0C1_BAD-01       -----------------------------------------EEEP-SPFR
A0A2K5VCD8_BAD-01       -----------------------------------------EEEP-SPFR
F7GVS7_BAD-01           -----------------------------------------EEEP-SPFR
A0A2K6E7J3_BAD-01       -----------------------------------------EEEP-SPFR
A0A2K5XJR2_BAD-01       -----------------------------------------EEEP-SPFR
A0A2I3MCN5_BAD-04       -----------------------------------------EEEP-SPFR
A0A2K6N1A1_BAD-01       -----------------------------------------EEEP-SPFR
A0A2K6PUM5_BAD-01       -----------------------------------------EEEP-SPFR
A0A2K5HKW9_BAD-01       -----------------------------------------EEEP-SPFR
B4DZQ9_BAD-01           -----------------------------------------GEEP-SPFR
A0A2K6GWV0_BAD-01       -----------------------------------------EEEP-SPFR
F6SJL0_BAD-01           -----------------------------------------EEEP-SPFR
A0A2I3MCN5_BAD-01       -----------------------------------------EEEP-SPFR
A0A2I2Z8C7_BAD-01       -----------------------------------------GEEP-SPFR
A0A2I2Z8C7_BAD-02       -----------------------------------------GEEP-SPFR
Q92934_BAD-01           -----------------------------------------GEEP-SPFR
Q92934_BAD-02           -----------------------------------------GEEP-SPFR
A0A2I3TBK7_BAD-02       -----------------------------------------GEEP-SPFR
A0A2R8Z697_BAD-01       -----------------------------------------GEEP-SPFR
A0A2J8TYJ3_BAD-01       -----------------------------------------GEEP-SPFR
F1PK10_BAD-01           -----------------------------------------EEEELSPFR
Q45KI9_BAD-01           -----------------------------------------EEEELSPFR
                                                                          

U3IW89_BCL2L11-01       --------------------------------------SS----------
Q6JTU4_BCL2L11-01       -----------------------------MRQAEPADMRP----------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          GLPRESPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPSSLL
F6RS78_BIK-01           LAFIGDEMEVRWM---LPHI-----AELPGVAVY----------------
B2KKY9_BCL2L11-01       NDEVWLSEHSHQH---LQMA------------APVAALPP----------
B8JK68_BCL2L11-01       NDEVWLSEHSHQH---LQMA------------APVAALPP----------
A0A2K6KS56_BBC3-02      R------VLYNLIMGLLPLP-----RGHRAPEMEPN--------------
F7G1G0_HRK-01           EAAGSGGGGLPAY---WAWL-----CAAAHVAALAAWLLR----------
A0A1U7R468_HRK-01       P------ALLPALRARWPWL-----CAAAQVAALAAWLLG----------
P62816_HRK-03           P------ALLPALRARWPWL-----CAAAQVAALAAWLLG----------
P62817_HRK-01           P------ALLPALRARWPWL-----CAAAQVAALAAWLLG----------
A0A287A5N9_HRK-01       P------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
H2NIS8_HRK-01           P------SALPTY---WPWL-----CAAAQVAALAAWLLG----------
A0A2K5KZ69_HRK-01       P------GALPTY---WPWL-----CAAAQVAALAAWLLS----------
H2Q6Y8_HRK-01           P------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
G3UH24_HRK-01           P------GALPTY---WPWL-----CAAAQVAALAAWLLR----------
A0A2K5BYA0_HRK-01       P------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
G3MWR6_HRK-01           S------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
U3E722_HRK-01           P------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
A0A0D9SC73_HRK-01       P------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
A0A337SQ56_HRK-01       P------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
G3QTJ6_HRK-01           P------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
O00198_HRK-01           P------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
A0A1D5R1E4_HRK-01       S------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
A0A2K6AYL7_HRK-01       P------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
G1QHD8_HRK-01           P------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
G1T7W1_HRK-01           P------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
H0Y001_HRK-01           P------GALTTY---WPWL-----CAAAQVAALAAWLLG----------
A0A096N944_HRK-01       P------GALPTY---WPWL-----CAAAQVAALAAWLLG----------
A0A2K6GL98_HRK-01       P------GALTTY---WPWL-----CAAAQVAALAAWLLG----------
E2RLD4_HRK-01           P------RALPTY---WPWL-----CAAAQVAALAAWLLG----------
F7GVS7_BAD-04           A------RP-------------------DLMSHDPSPTPS----------
Q2PG01_BAD-01           S------SSWTRV---FQSW-----WDRNLGRGSSAPSQ-----------
A0A2I3H4B2_BAD-01       S------SSWTRV---FQSW-----WDRNLGRGSSAPSQ-----------
K7GA86_BCL2L11-01       C------QAFNHY---LSAMGKQDHASRWESPSIREDMQP----------
G3SU55_BCL2L11-01       C------QAINHY---LSAM-----ASMRQSQALPADLRP----------
G3W979_BCL2L11-01       C------QAFNHY---LSAM---DTASMRQSQSIPADMRP----------
O43521_BCL2L11-11       H------PGWSAL---VRSW-----LTATSNSQVQAVLLP----------
F7HHA9_BCL2L11-08       C------PSWSAL---VLSW-----LTATSNSQVQAVLLP----------
A0A1U8BW10_BCL2L11      C------QAFNHY---LSAM-----DLCENLKHEWQ-IHG----------
O54918_BCL2L11-03       C------QAFNHY---LSAM-----DQLENLNQVAQNIHG----------
O43521_BCL2L11-19       C------QAFNHY---LSAM-----VREIEEVVV----------------
O43521_BCL2L11-07       C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2I3HW02_BCL2L11      C------QAFNHY---LSAM-----DEAAGSSL-----------------
A0A2K6TRZ5_BCL2L11      C------QAFNHY---LSAM-----DEATGSSL--A-LRR----------
A0A2K5HZI7_BCL2L11      C------QAFNHY---LSAM-----DEATGSSLRIA-LHR----------
A0A2K5NU92_BCL2L11      C------QAFNHY---LSAM-----DEATGSSLRIA-LHR----------
A0A2K5Z8B6_BCL2L11      C------QAFNHY---LSAM-----DEATGSSLGIA-LHR----------
A0A2I2YQ13_BCL2L11      C------QAFNHY---LSAM-----DDSAGSSLRIA-LHR----------
O43521_BCL2L11-23       C------QAFNHY---LSAM-----DDSAGSSLRIA-LHR----------
A0A2R9CA99_BCL2L11      C------QAFNHY---LSAM-----DDSAGSSLRIA-LHR----------
A0A2J8JCT2_BCL2L11      C------QAFNHY---LSAM-----DDSAGSSLRIA-LHR----------
F7HHA9_BCL2L11-07       C------QAFNHY---LSAM-----DEATGSSLGIA-LHR----------
A0A2K5CAB2_BCL2L11      C------QAFNHY---LSAM-----DEATESSLGIA-LRR----------
A0A2K5X2I7_BCL2L11      C------QAFNHY---LSAM-----DEATGSSLGIA-LHR----------
A0A2I3M6I1_BCL2L11      C------QAFNHY---LSAM-----DEATGSSLGIA-LHR----------
C1KGB8_BCL2L11-01       -------------------------ASMRQSQAEPADMRP----------
A0A2K6GE31_BCL2L11      -------------------------ASMRQFQAEPADMRP----------
A0A337SW42_BCL2L11      -------------------------ASMRQPQAVPADMRP----------
O43521_BCL2L11-10       -------------------------ASMRQAE--PADMRP----------
O43521_BCL2L11-20       -------------------------ASMRQAE--PADMRP----------
A0A2I2YQ13_BCL2L11      -------------------------ASMRQAE--PADMRP----------
O43521_BCL2L11-17       -------------------------ASMRQAE--PADMRP----------
O43521_BCL2L11-13       -------------------------ASMRQAE--PADMRP----------
A0A2I3HW02_BCL2L11      -------------------------ASMRQAE--PADMRP----------
A0A2R9CA99_BCL2L11      -------------------------ASMRQAE--PADMRP----------
A0A2J8JCT2_BCL2L11      -------------------------ASMRQAE--PADMRP----------
A0A2K5NU92_BCL2L11      -------------------------ASRRQAE--PADMRP----------
A0A2K5X2I7_BCL2L11      -------------------------ASRRQAE--PADMRP----------
F7HHA9_BCL2L11-05       -------------------------ASRRQAE--PADMRP----------
A0A2K5Z8B6_BCL2L11      -------------------------ASRRQAE--PADMRP----------
A0A2K5HZI7_BCL2L11      -------------------------ASRRQAE--PADMRP----------
A0A2K6KJP8_BCL2L11      -------------------------ASRRQAE--PADMRP----------
A0A2K6QIL2_BCL2L11      -------------------------ASRRQAE--PADMRP----------
A0A2K5CAB2_BCL2L11      C------QAFNHY---LSAM------------GDISLWFR----------
A0A2K5Z8B6_BCL2L11      C------QAFNHY---LSAM-----VVILEDIGDSSL-FG----------
A0A2K6KJP8_BCL2L11      C------QAFNHY---LSAM-----VVILEDIGDTSLWFG----------
A0A2K6QIL2_BCL2L11      C------QAFNHY---LSAM-----VVILEDIGDTSLWFG----------
F6XMC1_BCL2L11-09       C------QAFNHY---LSAM-----VVIRMDIGDISLWFR----------
A0A2K6TRZ5_BCL2L11      C------QAFNHY---LSAM-----VVIRMDIGDISLWFR----------
A0A2K5HZI7_BCL2L11      C------QAFNHY---LSAM-----VVILEDIGDTSLWFG----------
A0A2R9CA99_BCL2L11      C------QAFNHY---LSAM-----VVILEDIGDLSLCFG----------
A0A2J8JCT2_BCL2L11      C------QAFNHY---LSAM-----VVILEDIGDLSLCFG----------
A0A2K5NU92_BCL2L11      C------QAFNHY---LSAM-----VVILEDIGDSSLWFG----------
A0A2K5X2I7_BCL2L11      C------QAFNHY---LSAM-----VVILEDIGDSSLWFG----------
F7HHA9_BCL2L11-09       C------QAFNHY---LSAM-----VVILEDIGDSSLWFG----------
A0A2K6E226_BCL2L11      C------QAFNHY---LSAM-----VVILEDIGDSSLWFG----------
A0A2I3M6I1_BCL2L11      C------QAFNHY---LSAM-----VVILEDIGDSSLWFG----------
A0A2I2YQ13_BCL2L11      C------QAFNHY---LSAM-----VVILEDIGDLSLWFG----------
O43521_BCL2L11-06       C------QAFNHY---LSAM-----VVILEDIGDLSLCFG----------
O43521_BCL2L11-15       C------QAFNHY---LSAM-----VVILEDIGDLSLCFG----------
A0A2I3HW02_BCL2L11      C------QAFNHY---LSAM-----VVILEDVGDISLWFG----------
F1SU81_BCL2L11-03       C------QAFNHY---LSAM-----ASMRQSQAEPADMRP----------
A0A0D9RWE0_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
O43521_BCL2L11-05       C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
O43521_BCL2L11-25       C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
O54918_BCL2L11-08       -------------------------ASIRQSQEEPEDLRP----------
O54918_BCL2L11-06       -------------------------ASIRQSQEEPEDLRP----------
A0A1U8BW10_BCL2L11      C------QAFNHY---LSAM-----ASIRQSQEEPADIRP----------
Q2YDF0_BCL2L11-01       C------QAFNHY---LSAM-----ASMRQSQAVPADTRP----------
A0A287DFJ0_BCL2L11      C------QAFNHY---LSAM-----ASMRESQAEPADMRP----------
O54918_BCL2L11-05       C------QAFNHY---LSAM-----ASIRQSQEEPEDLRP----------
O88498_BCL2L11-02       C------QAFNHY---LSAM-----ASIRQSQEEPEDLRP----------
A0A2K6GE31_BCL2L11      C------QAFNHY---LSAM-----ASMRQFQAEPADMRP----------
A0A2K5CAB2_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
A0A2K6TRZ5_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
A0A2K6QIL2_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5NU92_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5HZI7_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5X2I7_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K6E226_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5Z8B6_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2I3M6I1_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2I3M6I1_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K6KJP8_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2I2YQ13_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
O43521_BCL2L11-02       C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
A0A2R9CA99_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
A0A2J8JCT2_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
H2P5E2_BCL2L11-01       C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
A0A337SW42_BCL2L11      C------QAFNHY---LSAM-----ASMRQPQAVPADMRP----------
A0A286XJN2_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQAGPPHLRP----------
A0A1S3FHA8_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQEEPADLRP----------
Q4KMV9_BCL2L11-01       C------QAFNHL---LSAM-----ADRN----PVNQMSP----------
F7FTC8_BCL2L11-01       C------QAFNHY---LSAM-----ASIRQPQSVPEDMRP----------
A0A2K6E226_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
M3YDI3_BCL2L11-01       C------QAFNHY---LSAM-----ASRRQSQAVPADMRP----------
F6XMC1_BCL2L11-02       C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
F6XMC1_BCL2L11-01       C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
F7CXT2_BCL2L11-01       C------QAFNHY---LSAM-----ASMRQSQSIPADMRP----------
F6XMC1_BCL2L11-08       C------QAFNHY---LSAM-----GYRLTGQQPCLPWKV----------
A0A337SW42_BCL2L11      C------QAFNHY---LSAM-----VRAIEEGVL----------------
A0A337SW42_BCL2L11      C------QAFNHY---LSAM-----------GLFE---------------
A0A2K6GE31_BCL2L11      C------QAFNHY---LSAM----------GIFE----------------
A0A2K6GE31_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2K5NU92_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2K5HZI7_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2I2YQ13_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
O43521_BCL2L11-08       C------QAFNHY---LSAM-----VREIEEVVV----------------
O43521_BCL2L11-22       C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2K5X2I7_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
F7HHA9_BCL2L11-03       C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2K6E226_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2K5Z8B6_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2I3HW02_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2R9CA99_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2J8JCT2_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2I3M6I1_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2K6KJP8_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2K6QIL2_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2K5CAB2_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
F6XMC1_BCL2L11-06       C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2K6TRZ5_BCL2L11      C------QAFNHY---LSAM-----VREIEEVVV----------------
A0A2K5CAB2_BCL2L11      C------QAFNHY---LSAM-----ADWD---------------------
A0A2K6TRZ5_BCL2L11      C------QAFNHY---LSAM-----ADWD---------------------
A0A2K5CAB2_BCL2L11      C------QAFNHY---LSAM-----GIFE---------------------
F6XMC1_BCL2L11-04       C------QAFNHY---LSAM-----GIFE---------------------
A0A2K6TRZ5_BCL2L11      C------QAFNHY---LSAM-----GIFE---------------------
A0A2K5NU92_BCL2L11      C------QAFNHY---LSAM-----GIFE---------------------
A0A2I2YQ13_BCL2L11      C------QAFNHY---LSAM-----GIFE---------------------
O43521_BCL2L11-21       C------QAFNHY---LSAM-----GIFE---------------------
A0A2K5X2I7_BCL2L11      C------QAFNHY---LSAM-----GIFE---------------------
F7HHA9_BCL2L11-01       C------QAFNHY---LSAM-----GIFE---------------------
A0A2K6E226_BCL2L11      C------QAFNHY---LSAM-----GIFE---------------------
A0A2K5Z8B6_BCL2L11      C------QAFNHY---LSAM-----GIFE---------------------
A0A2I3HW02_BCL2L11      C------QAFNHY---LSAM-----GIFE---------------------
A0A2R9CA99_BCL2L11      C------QAFNHY---LSAM-----GIFE---------------------
A0A2J8JCT2_BCL2L11      C------QAFNHY---LSAM-----GIFE---------------------
A0A2I3M6I1_BCL2L11      C------QAFNHY---LSAM-----GIFE---------------------
A0A2K6KJP8_BCL2L11      C------QAFNHY---LSAM-----GIFE---------------------
A0A2K6QIL2_BCL2L11      C------QAFNHY---LSAM-----GIFE---------------------
A0A2K5NU92_BCL2L11      C------QAFNHY---LSAM-----ANWD---------------------
A0A2K5HZI7_BCL2L11      C------QAFNHY---LSAM-----ANWD---------------------
A0A2I2YQ13_BCL2L11      C------QAFNHY---LSAM-----ANWD---------------------
O43521_BCL2L11-24       C------QAFNHY---LSAM-----ANWD---------------------
O43521_BCL2L11-12       C------QAFNHY---LSAM-----ANWD---------------------
A0A2K5X2I7_BCL2L11      C------QAFNHY---LSAM-----ANWD---------------------
F7HHA9_BCL2L11-06       C------QAFNHY---LSAM-----ANWD---------------------
A0A2K6E226_BCL2L11      C------QAFNHY---LSAM-----ANWD---------------------
A0A2K5Z8B6_BCL2L11      C------QAFNHY---LSAM-----ANWD---------------------
A0A2I3HW02_BCL2L11      C------QAFNHY---LSAM-----ANWD---------------------
A0A2R9CA99_BCL2L11      C------QAFNHY---LSAM-----ANWD---------------------
A0A2J8JCT2_BCL2L11      C------QAFNHY---LSAM-----ANWD---------------------
A0A2I3M6I1_BCL2L11      C------QAFNHY---LSAM-----ANWD---------------------
A0A2K6KJP8_BCL2L11      C------QAFNHY---LSAM-----ANWD---------------------
A0A2K6QIL2_BCL2L11      C------QAFNHY---LSAM-----ANWD---------------------
A0A2K5HZI7_BCL2L11      C------QAFNHY---LSAM-----GVFE---------------------
O54918_BCL2L11-01       C------QAFNHY---LSAM-----ASIRQSQEEPEDLRP----------
O88498_BCL2L11-01       C------QAFNHY---LSAM-----ASIRQSQEEPEDLRP----------
A0A1U8BW10_BCL2L11      C------QAFNHY---LSAM-----ASIRQSQEEPADIRP----------
A0A287DFJ0_BCL2L11      C------QAFNHY---LSAM-----ASMRESQAEPADMRP----------
A0A2K6GE31_BCL2L11      C------QAFNHY---LSAM-----ASMRQFQAEPADMRP----------
A0A2K6GE31_BCL2L11      C------QAFNHY---LSAM-----ASMRQFQAEPADMRP----------
A0A2K5CAB2_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
F6XMC1_BCL2L11-07       C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
A0A2K6TRZ5_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
F6XMC1_BCL2L11-05       C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
A0A2K6TRZ5_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
A0A2K5CAB2_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
A0A2K5NU92_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5HZI7_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5X2I7_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
F7HHA9_BCL2L11-02       C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K6E226_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5Z8B6_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2I3M6I1_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K6KJP8_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K6QIL2_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2I2YQ13_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
O43521_BCL2L11-16       C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
O43521_BCL2L11-09       C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
A0A2R9CA99_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
A0A2J8JCT2_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
A0A2K5NU92_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5HZI7_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5X2I7_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
F7HHA9_BCL2L11-04       C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K6E226_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5Z8B6_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2I3M6I1_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K6KJP8_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K6QIL2_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2I2YQ13_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
O43521_BCL2L11-18       C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
A0A2I3HW02_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
A0A2R9CA99_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
A0A2J8JCT2_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
A0A2K5CAB2_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
A0A2K5CAB2_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
F6XMC1_BCL2L11-03       C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
A0A2K6TRZ5_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
A0A2K6TRZ5_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQAEPAGMRP----------
A0A2K6QIL2_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K6QIL2_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5NU92_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5HZI7_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5X2I7_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K6E226_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K6E226_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K5Z8B6_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2I3M6I1_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K6KJP8_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2K6KJP8_BCL2L11      C------QAFNHY---LSAM-----ASRR--QAEPADMRP----------
A0A2I2YQ13_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
O43521_BCL2L11-03       C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
A0A2I3HW02_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
A0A2R9CA99_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
A0A2J8JCT2_BCL2L11      C------QAFNHY---LSAM-----ASMR--QAEPADMRP----------
F1SU81_BCL2L11-02       C------QAFNHY---LSAM-----ASMRQSQAEPADMRP----------
A0A337SW42_BCL2L11      C------QAFNHY---LSAM-----ASMRQPQAVPADMRP----------
W5PY58_BCL2L11-01       C------QAFNHY---LSAM-----ASMRQSQAVPADTRP----------
F7A7D2_BCL2L11-01       C------QAFNHY---LSAM-----ASMRQSQAVPADMRP----------
A0A286XJN2_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQAGPPHLRP----------
A0A286XJN2_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQAGPPHLRP----------
G1SSY0_BCL2L11-01       C------QAFNHY---LSAM-----ASMRQSQAEPADTRP----------
H0XW23_BCL2L11-01       C------QAFNHY---LSAM-----ASMRQSQAEPADLRP----------
A0A1S3FHA8_BCL2L11      C------QAFNHY---LSAM-----ASMRQSQEEPADLRP----------
A0A337SW42_BCL2L11      C------QAFNHY---LSAM-----ASMRQPQAVPADMRP----------
G1LDR8_BCL2L11-01       C------QAFNHY---LSAM-----ASMRQSQAVPADMRP----------
J9NWV6_BCL2L11-01       C------QAFNHY---LSAM-----ASMRQSQAVPADMRP----------
F1SU81_BCL2L11-01       C------QAFNHY---LSAM-----ASMRQSQAEPADMRP----------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A9XRH0_BMF-01           A------RT-----------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       S------RRPPSSGLHSVMA-----ASSGG--------------------
O61667_EGL1-01          D------SE----------------------ISSI---------------
A3KND0_BMF-01           G------KE-----------------------------------------
A0A2K5F6X4_BBC3-02      G------PT----------------------QAAPGVRGEEEQW------
A0A337SQV0_BBC3-03      G------PT----------------------QAAPGVRGEEEQW------
F1SMU1_PMAIP1-01        R------NT----------------------QTNPTRVALPPDP------
Q9BXH1_BBC3-04          G------RP----------------------LPPPDTLAS----------
K7E5Y2_BBC3-02          G------P--------------------------PGVLGPEHGDQGEQQ-
F7CQN5_BBC3-01          G------PT----------------------QAAPGVRGEE-----EQW-
A0A2I3HWI8_BBC3-03      G------PT----------------------QAAPGVRGEE-----EQW-
A0A2K6FQZ3_BBC3-04      G------PT----------------------QAAPGVRGEE-----EQW-
Q9BXH1_BBC3-05          G------PT----------------------QAAPGVRGEE-----EQW-
A0A2R9BZA9_BBC3-01      G------PT----------------------QAAPGVRGEE-----EQW-
A0A2I3RGH5_BBC3-03      G------PT----------------------QAAPGVRGEE-----EQW-
A0A2K5P2T8_BBC3-03      G------PT----------------------QAAPGVRGEE-----EQW-
A0A2K5V8J3_BBC3-03      G------PT----------------------QAAPGVRGEE-----EQW-
F7FFP6_BBC3-03          G------PT----------------------QAAPGVRGEE-----EQW-
A0A2K6ASP2_BBC3-03      G------PT----------------------QAAPGVRGEE-----EQW-
A0A2I3N2Z9_BBC3-03      G------PT----------------------QAAPGVRGEE-----EQW-
A0A2K6QZU4_BBC3-04      G------PT----------------------QAAPGVRGEE-----EQW-
A0A2R8MW85_BBC3-03      G------PT----------------------QAAPGVRGEE-----EQW-
A0A2K6STD6_BBC3-02      G------PT----------------------QAAPGVRGEE-----EQW-
G3T2N1_BBC3-01          -------PT----------------------QAAPGVRGED-----EQW-
M3Y0R3_BBC3-01          G------PT----------------------QAAPGVRGEE-----EQW-
A0A1U7R5N5_BBC3-01      G------PT----------------------QAAPGVRGEE-----EEW-
Q99ML1_BBC3-02          G------PT----------------------QAAPGVRVEE-----EEW-
Q80ZG6_BBC3-01          G------PT----------------------QAAPGVRVEE-----EEW-
H0XQ00_BBC3-01          G------PT----------------------QAAPEVRGEE-----EQW-
J9NTK9_BBC3-01          G------PT----------------------QAAPGVRGEE-----EQW-
A0A337SQV0_BBC3-02      G------PT----------------------QAAPGVRGEE-----EQW-
F1RM01_BBC3-01          G------PT----------------------QAAPGIRGEE-----EQW-
A0A2K6FQZ3_BBC3-01      G------PT----------------------QAAPGVRGEE-----EQW-
Q9BXH1_BBC3-06          G------PT----------------------QAAPGVRGEE-----EQW-
A0A2I3RIG5_BBC3-02      G------PT----------------------QAAPGVRGEE-----EQW-
H2NZD3_BBC3-01          G------PT----------------------QAAPGVRGEE-----EQW-
A0A2K6QZU4_BBC3-01      G------PT----------------------QAAPGVRGEE-----EQW-
A0A0D9S2H2_BBC3-01      G------PT----------------------QAAPGVRGEE-----EQW-
B4DQK3_BBC3-01          G------PT----------------------QAAPGVRGEE-----EQW-
F6TGJ4_BMF-01           G------HA----------G-----YLLYL-PQNSPA--R----------
G1PAU1_BMF-01           G------NA----------G-----YRLPL-PASFPAGSP----------
A0A1U8CPE0_BMF-02       G------NA----------G-----YRLPL-PASFPAGLP----------
A0A286XXB0_BMF-03       G------NA----------G-----YRLPL-PASFPAGLP----------
I3MDS9_BMF-02           G------NA----------G-----YRLPL-PASFPAGLP----------
A0A287AIU8_BMF-05       G------NA----------G-----YRLPL-PAGFPAGLP----------
A0A287AIU8_BMF-03       G------NA----------G-----YRLPL-PAGFPAGLP----------
A0A287AIU8_BMF-01       G------NA----------G-----YRLPL-PAGFPAGLP----------
A0A287AIU8_BMF-02       G------NA----------G-----YRLPL-PAGFPAGLP----------
A0A287AIU8_BMF-04       G------NA----------G-----YRLPL-PAGFPAGLP----------
A0A1S3EQA2_BMF-02       G------SA----------G-----YRLPL-PAGFPA-------------
A2AV74_BMF-02           G------NA----------G-----YRLPL-PASFPAGSP----------
A0A337SQV0_BBC3-01      A------RP----------A-----RRPRR-PRPAARRLP----------
Q9BXH1_BBC3-03          A------RP----------G-----CRPRR-PHPAARCLP----------
A0A2K5KGR6_BMF-01       A------PA----------E-----PKSRV-VADPPL-------------
A0A2K6FFR1_BMF-02       A------PA----------E-----PKSHV-VADPPL-------------
M3WRS0_BMF-02           A------PA----------K-----PPSSV-VADSPL-------------
A0A2K5E1W9_BMF-02       A------SA----------E-----PKSRV-VAGPPL-------------
F7HPK0_BMF-02           A------PA----------E-----PKSHV-VAGPPL-------------
A0A2K6TW86_BMF-03       A------PA----------E-----PKSCV-VAGPPL-------------
A0A2K6RAW8_BMF-02       A------PA----------E-----PKSRV-VADPPL-------------
G3QIN5_BMF-02           A------PA----------E-----PKSCV-VADPPL-------------
Q96LC9_BMF-07           A------PA----------E-----PKSCV-VADPPL-------------
Q96LC9_BMF-05           A------PA----------E-----PKSCV-VADPPL-------------
A0A2R9BS98_BMF-02       A------PA----------E-----PKSCV-VADPPL-------------
A0A2J8QDD5_BMF-01       A------PA----------E-----PKSCV-VADPPL-------------
A0A2K5MJY6_BMF-01       A------PA----------E-----PKSRV-VADPPL-------------
G7PAW6_BMF-01           A------PA----------E-----PKSRV-VADPPL-------------
A0A2K6B5G4_BMF-03       A------PA----------E-----PKSRV-VADPPL-------------
A0A2K5Z4C3_BMF-02       A------PA----------E-----PKSRV-VADPPL-------------
A0A096NTE9_BMF-03       A------PA----------E-----PKSRV-VADPPL-------------
A0A2I3HD83_BMF-01       A------PA----------E-----PKSRV-VADPPL-------------
A0A1S3EQA2_BMF-01       G------SA----------G-----YRLPL-PAGFPA-------------
Q8K589_BMF-01           G------NA----------G-----YRLPL-PASFPAGSA----------
A2AV74_BMF-01           G------NA----------G-----YRLPL-PASFPAGSP----------
I3MDS9_BMF-01           G------NA----------G-----YRLPL-PASFPAGLP----------
G3T7Z4_BMF-01           G------NA----------G-----YRLPL-PASFPAGLP----------
F6X3N6_BMF-01           G------NA----------G-----YRLPL-PASFPASLR----------
G3WDQ2_BMF-01           G------NA----------G-----YRLPL-PANFPSSLR----------
A0A1S3WU31_BMF-01       G------NA----------G-----YRLPL-PNSFPAGSP----------
Q96LC9_BMF-06           G------NA----------G-----YRLPL-PASFPAVLP----------
A0A286XXB0_BMF-02       G------NA----------G-----YRLPL-PASFPAGLP----------
J9PB65_BMF-01           G------NA----------G-----YRLPL-PASFPAGLP----------
A0A1U8CPE0_BMF-01       G------NA----------G-----YRLPL-PASFPAGLP----------
A0A286XXB0_BMF-01       G------NA----------G-----YRLPL-PASFPAGLP----------
G1SR62_BMF-01           G------NA----------G-----YRLPL-PASFPANFA----------
F6TJI0_BMF-01           G------NA----------G-----YRLPL-PASFPAGLP----------
Q05KI3_BMF-01           G------HA----------G-----YRLPL-PASFPAGLP----------
W5QFV1_BMF-01           G------NA----------G-----YRLPL-PASFPAGLP----------
M3WRS0_BMF-01           G------NA----------G-----YRLPL-PASFPAGLP----------
M3YAD5_BMF-01           G------NA----------G-----YRLPL-PASFPAGLP----------
A0A2K6FFR1_BMF-01       G------NA----------G-----YRLPL-PASFPAGLP----------
H0WYH6_BMF-01           G------NV----------G-----YRLPL-PASFPAGLP----------
A0A096NTE9_BMF-01       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2K6L933_BMF-02       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A096NTE9_BMF-02       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2K5MJY6_BMF-02       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2K5KGR6_BMF-02       G------NA----------G-----YRLPL-PASFPAVLP----------
G7PAW6_BMF-02           G------NA----------G-----YRLPL-PASFPAVLP----------
F7CM09_BMF-02           G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2K6B5G4_BMF-02       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2K6B5G4_BMF-01       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2K6B5G4_BMF-04       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2K5Z4C3_BMF-01       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2K6L933_BMF-03       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2K6L933_BMF-01       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2K6RAW8_BMF-01       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A0D9R4R5_BMF-01       G------NA----------G-----YRLPL-PASFPAVLP----------
F7HPK0_BMF-01           G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2K5E1W9_BMF-01       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2K6TW86_BMF-02       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2K6TW86_BMF-01       G------NA----------G-----YRLPL-PASFPAVLP----------
G3QIN5_BMF-01           G------NA----------G-----YRLPL-PASFPAVLP----------
Q96LC9_BMF-01           G------NA----------G-----YRLPL-PASFPAVLP----------
Q96LC9_BMF-02           G------NA----------G-----YRLPL-PASFPAVLP----------
Q96LC9_BMF-03           G------NA----------G-----YRLPL-PASFPAVLP----------
Q96LC9_BMF-04           G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2R9BS98_BMF-01       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2J8QDD5_BMF-02       G------NA----------G-----YRLPL-PASFPAVLP----------
A0A2J8T301_BMF-01       G------NA----------G-----YRLPL-PASFPAVLP----------
H9GL49_BMF-01           G------NA----------G-----YRLHVSPIGFSLNPH----------
A9XRG9_BMF-01           G------KSTPTSPAFQQGN-----YPFSTSPVRQFLSLK----------
K7FRX2_BMF-01           G------NA----------G-----YRLHEPPVGFALNPH----------
U3JS06_BMF-01           G------SA----------G-----YRLHVPPAGFVLDPH----------
H0ZMX5_BMF-01           G------SA----------G-----YRLHVPPAGFVLDPH----------
A9XRG9_BMF-02           G------NA----------G-----YRLHVPPVGFALDPN----------
A9XRG9_BMF-03           G------NA----------G-----YRLHVPPVGFALDPN----------
G1NHG8_BMF-01           G------NA----------G-----YRLHVPPVGFALDPN----------
W5N4P7_BMF-01           G------NA----------A-----FRLHF-PAHFEQGGD-------EEE
I3K2D6_BMF-01           G------NA----------G-----FRLHF-PARFELVGDHRARRQEIAE
A0A096LRV0_BMF-01       G------NA----------G-----FRLHF-PAHFELVGDFDAR---QQE
A0A2U9CJH3_BMF-01       G------NA----------G-----FRLHF-PAHFELFGDQEVRGHESEE
Q0GKC7_BMF-01           -------------------------------PEPRPAQSV----------
A0A2K5JY52_PMAIP1-      Q------------------------------TELPAETSE----------
A0A096MPU8_PMAIP1-      Q------------------------------TELPAETSE----------
A0A2K5ZWH1_PMAIP1-      Q------------------------------TELPAETSE----------
A0A2K5VPX2_PMAIP1-      Q------------------------------TELPAETSE----------
A0A2K6BV75_PMAIP1-      Q------------------------------TKLPAETSE----------
A0A2K6KJF2_PMAIP1-      Q------------------------------TELPAETFE----------
A0A2K6NC45_PMAIP1-      Q------------------------------TELPAETFE----------
Q13794_PMAIP1-02        Q------------------------------TELPAETSE----------
A0A2R9AKC9_PMAIP1-      Q------------------------------TELPAETSE----------
A0A1D5QGJ8_PMAIP1-      Q------------------------------TELPAETSE----------
A0A2I2YVQ5_PMAIP1-      Q------------------------------TELPAETSE----------
A0A2I3SX38_PMAIP1-      Q------------------------------TELPAETSE----------
C1C3S9_BAD-01           -------------------------------PRPKSASAA----------
F6Z067_BAD-01           -------------------------------PRPKSASAA----------
M3XHJ5_BCL2L11-01       -------------------------------PAPVSVHKA----------
W5QCU2_BIK-01           F------------------------------LTLRDRVSP----------
O70337_BIK-04           V------------------------------LTPGAWVSP----------
O70337_BIK-02           V------------------------------LTPGAWVSP----------
O70337_BIK-01           V------------------------------LTPGAWVSP----------
Q925D2_BIK-01           V------------------------------FTPGAWVSP----------
G1TZR9_BIK-01           P------WG----------------------RGAAAPAAV----------
F1PUF4_BIK-01           F------------------------------LTFRNRVSP----------
H0XAE7_BIK-01           S------------------------------LSRGPWVCP----------
A0A2K6FM79_BIK-01       S------------------------------LSPRPWVCP----------
A0A1S3FUQ7_BIK-01       P------------------------------PIPRLQVSP----------
H0W025_BIK-01           C------GR----------------------PASRAWVSP----------
A0A2K5CLG5_BIK-01       S------------------------------LSSGSWVSR----------
F7FUT7_BIK-01           S------------------------------LSSGSWVSR----------
A0A2K6TBD7_BIK-01       S------------------------------LSSGSWVSG----------
H2P4N6_BIK-01           S------------------------------L------------------
G1S1X2_BIK-01           S------------------------------PNPGSRVSR----------
G3QCT2_BIK-01           S------------------------------PNPGSWVSR----------
A0A2R8ZXD2_BIK-01       S------------------------------PNPRSWVSR----------
H2QLU7_BIK-01           S------------------------------PNPGSWVSR----------
Q13323_BIK-01           S------------------------------PNPGSWVSC----------
A0A2K6MCW0_BIK-01       S------------------------------LNPGSQVSR----------
A0A2K6QK74_BIK-01       S------------------------------LNPGSQVSR----------
A0A0D9QZY8_BIK-01       S------------------------------LNPGSWVSR----------
A0A2K5VW94_BIK-01       S------------------------------PNPRSWVSR----------
A0A2K6DBJ4_BIK-01       S------------------------------PNPRSWVSR----------
A0A2K5J4Q7_BIK-01       S------------------------------PNPGSRVSR----------
A0A096NKG5_BIK-01       S------------------------------PNPRSWVSR----------
A0A2K5LDM6_BIK-01       S------------------------------PNPRSWVSH----------
A0A2K5XSA1_BIK-01       S------------------------------PNPRSWVSR----------
I3K7B6_BAD-01           R------RS----------------------KSAPPALWA----------
B5X1T1_BAD-01           S------RS----------------------QSAPPTLWA----------
Q4V925_BAD-02           P------RS----------------------RSAPPALWA----------
Q4V925_BAD-03           P------RS----------------------RSAPPALWA----------
A7MCM4_BAD-01           P------RS----------------------RSAPPALWA----------
Q4V925_BAD-04           P------RS----------------------RSAPPALWA----------
Q4V925_BAD-01           P------RS----------------------RSAPPALWA----------
G3Q8B3_BAD-01           V------RS----------------------KSAPPALWA----------
A0A087X8P8_BAD-01       G------RS----------------------NSAPPSLWA----------
E7FBJ6_BAD-01           G------RS----------------------QSAPAALWK----------
B5XEF1_BAD-01           G------RS----------------------QSAPPALWA----------
G1SS60_BAD-01           G------RS----------------------RSAPPNLWA----------
Q9GL49_PMAIP1-01        S------RS----------------------FAAKFRLLF----------
H3D8J8_BAD-01           G------RS----------------------RSAPPALWA----------
H3ANP3_BAD-03           T------RS----------------------RSAPPNFWA----------
H3ANP3_BAD-04           T------RS----------------------RSAPPNFWA----------
H3ANP3_BAD-01           T------RS----------------------RSAPPNFWA----------
H3ANP3_BAD-02           T------RS----------------------RSAPPNFWA----------
A0A337SAW2_BAD-01       G------RS----------------------RSAPPNLWA----------
A0A2U9BAC9_BAD-01       G------RS----------------------KSAPPALWA----------
A0A2I3TBK7_BAD-01       G------QG-----------------------------------------
A0A2R8Z697_BAD-02       G------QG-----------------------------------------
A0A2I2Z8C7_BAD-03       G------QG-----------------------------------------
Q92934_BAD-03           G------QG-----------------------------------------
A0A2K5M0C1_BAD-02       G------QG-----------------------------------------
A0A2K5XJR2_BAD-02       G------QG-----------------------------------------
A0A2I3MCN5_BAD-03       G------QG-----------------------------------------
A0A2K5VCD8_BAD-02       G------QG-----------------------------------------
F7GVS7_BAD-02           G------QG-----------------------------------------
A0A2K6E7J3_BAD-02       G------QG-----------------------------------------
A0A2K5E6K7_BAD-02       G------QG-----------------------------------------
A0A2K6TG62_BAD-02       G------QG-----------------------------------------
A0A2K5E6K7_BAD-03       S---------------------------------E---------------
A0A2K5HKW9_BAD-02       S------EA----------------------QHAE---------------
A0A2K6N1A1_BAD-02       S------EA----------------------QLAE---------------
A0A2K6PUM5_BAD-02       S------EA----------------------QLAE---------------
A0A2K5M0C1_BAD-03       S------EA----------------------QHAE---------------
A0A2K5VCD8_BAD-03       S------EA----------------------QHAE---------------
F7GVS7_BAD-03           S------EA----------------------QHAE---------------
A0A2K5XJR2_BAD-03       S------EA----------------------QLAE---------------
A0A2I3MCN5_BAD-02       S------EA----------------------QHAE---------------
A0A2K6E7J3_BAD-03       S------EA----------------------QHAE---------------
A0A2I2Z8C7_BAD-04       S------EA----------------------QHAE---------------
Q92934_BAD-04           S------EA----------------------QHAE---------------
A0A2I3TBK7_BAD-03       S------EA----------------------QHAE---------------
A0A2R8Z697_BAD-03       S------EA----------------------QHAE---------------
F6SJL0_BAD-02           S------EA----------------------QHTE---------------
A0A2K6TG62_BAD-03       S------EA----------------------QHTE---------------
G1P8C5_BAD-01           G------RS----------------------RSAPPNLWA----------
W5P8G9_BAD-01           G------RS----------------------RSAPPNLWA----------
G3VRY4_BAD-01           G------RS----------------------SSAPPILWA----------
G3VRY4_BAD-02           G------RS----------------------SSAPPILWA----------
G3TP47_BAD-01           G------RS----------------------LSAPPNLWA----------
I3MBM5_BAD-01           G------RS----------------------RSAPPNLWA----------
I3MBM5_BAD-02           G------RS----------------------RSAPPNLWA----------
A0A091DDU4_BAD-01       G------RS----------------------RSAPPNLWA----------
Q61337_BAD-02           G------RS----------------------RSAPPNLWA----------
Q61337_BAD-03           G------RS----------------------RSAPPNLWA----------
A0A1U7Q4V0_BAD-01       G------RS----------------------RSAPPNLWA----------
Q61337_BAD-01           G------RS----------------------RSAPPNLWA----------
G1MI17_BAD-01           G------RS----------------------SSAPPNLCA----------
A0A287AEF3_BAD-01       G------RS----------------------LSAPPILWA----------
O35147_BAD-01           G------RS----------------------RSAPPNLWA----------
M3YNE7_BAD-01           G------RS----------------------RSAPPNLCA----------
F1MUT9_BAD-01           G------RS----------------------RSAPPNLWA----------
Q3SYZ0_BAD-01           G------RS----------------------RSAPPNLWA----------
F7DN67_BAD-01           G------RS----------------------RSAPPNLWA----------
H0WVR2_BAD-01           G------RS----------------------RSAPPNLWA----------
H0V608_BAD-01           G------RS----------------------RSAPPNLWA----------
A0A1S3FL84_BAD-01       G------RS----------------------RSAPPNLWA----------
A0A2K5E6K7_BAD-01       G------RS----------------------RSAPPNLWA----------
A0A2K6TG62_BAD-01       G------RS----------------------RSAPPNLWA----------
A0A0D9R491_BAD-01       G------RS----------------------RSAPPNLWA----------
A0A2K5M0C1_BAD-01       G------RS----------------------RSAPPNLWA----------
A0A2K5VCD8_BAD-01       G------RS----------------------RSAPPNLWA----------
F7GVS7_BAD-01           G------RS----------------------RSAPPNLWA----------
A0A2K6E7J3_BAD-01       G------RS----------------------RSAPPNLWA----------
A0A2K5XJR2_BAD-01       G------RS----------------------RSAPPNLWA----------
A0A2I3MCN5_BAD-04       G------RS----------------------RSAPPNLWA----------
A0A2K6N1A1_BAD-01       G------RS----------------------RSAPPNLWA----------
A0A2K6PUM5_BAD-01       G------RS----------------------RSAPPNLWA----------
A0A2K5HKW9_BAD-01       G------RS----------------------RSAPPNLWA----------
B4DZQ9_BAD-01           G------RS----------------------RSAPPNLWA----------
A0A2K6GWV0_BAD-01       G------RS----------------------RSAPPNLWA----------
F6SJL0_BAD-01           G------RS----------------------RSAPPNLWA----------
A0A2I3MCN5_BAD-01       G------RS----------------------RSAPPNLWA----------
A0A2I2Z8C7_BAD-01       G------RS----------------------RSAPPNLWA----------
A0A2I2Z8C7_BAD-02       G------RS----------------------RSAPPNLWA----------
Q92934_BAD-01           G------RS----------------------RSAPPNLWA----------
Q92934_BAD-02           G------RS----------------------RSAPPNLWA----------
A0A2I3TBK7_BAD-02       G------RS----------------------RSAPPNLWA----------
A0A2R8Z697_BAD-01       G------RS----------------------RSAPPNLWA----------
A0A2J8TYJ3_BAD-01       G------RS----------------------RSAPPNLWA----------
F1PK10_BAD-01           G------RS----------------------SSAPPNLCA----------
Q45KI9_BAD-01           G------RS----------------------SSAPPNLCA----------
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          PLAYFCTRQPRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQ
F6RS78_BIK-01           --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
G3MWR6_HRK-01           --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A1S3FHA8_BCL2L11      --------------------------------------------------
Q4KMV9_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-03       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
F7A7D2_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FHA8_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-01       --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
F7CQN5_BBC3-01          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
F6TGJ4_BMF-01           ----FGEEVDNRRQE-QSA-------------------------------
G1PAU1_BMF-01           ----LGEQPPEGQWQHHRA-------------------------------
A0A1U8CPE0_BMF-02       ----LGEQPPEGQWQ-HRA-------------------------------
A0A286XXB0_BMF-03       ----LGEQPPEGQWQ-HRA-------------------------------
I3MDS9_BMF-02           ----LGEQPPEGQWQ-HRA-------------------------------
A0A287AIU8_BMF-05       ----LGEQPPEGQWQ-HRA-------------------------------
A0A287AIU8_BMF-03       ----LGEQPPEGQWQ-HRA-------------------------------
A0A287AIU8_BMF-01       ----LGEQPPEGQWQ-HRA-------------------------------
A0A287AIU8_BMF-02       ----LGEQPPEGQWQ-HRA-------------------------------
A0A287AIU8_BMF-04       ----LGEQPPEGQWQ-HRA-------------------------------
A0A1S3EQA2_BMF-02       -----AQQPPEG----HRV-------------------------------
A2AV74_BMF-02           ----LGEQPPEGQFLQHRA-------------------------------
A0A337SQV0_BBC3-01      ----LRPHRPAR---RHRRPGGPPLAWGSPQPAPRAAPRRSSALTLAGRA
Q9BXH1_BBC3-03          ----LRPHRPTR---RHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGA
A0A2K5KGR6_BMF-01       --------PAQPCF-EWRR-------------------------------
A0A2K6FFR1_BMF-02       --------PTQPCF-ERRR-------------------------------
M3WRS0_BMF-02           --------PTQPGF-ECRR-------------------------------
A0A2K5E1W9_BMF-02       --------SAQPGF-EWRR-------------------------------
F7HPK0_BMF-02           --------PAQPGF-EWRR-------------------------------
A0A2K6TW86_BMF-03       --------PAQPGF-EWRR-------------------------------
A0A2K6RAW8_BMF-02       --------PAQPCF-EWRR-------------------------------
G3QIN5_BMF-02           --------PAQPCF-EWRR-------------------------------
Q96LC9_BMF-07           --------PAQPCF-EWRR-------------------------------
Q96LC9_BMF-05           --------PAQPCF-EWRR-------------------------------
A0A2R9BS98_BMF-02       --------PAQPCF-EWRR-------------------------------
A0A2J8QDD5_BMF-01       --------PAQPCF-EWRR-------------------------------
A0A2K5MJY6_BMF-01       --------PAQPCF-EWRR-------------------------------
G7PAW6_BMF-01           --------PAQPCF-EWRR-------------------------------
A0A2K6B5G4_BMF-03       --------PAQPCF-EWRR-------------------------------
A0A2K5Z4C3_BMF-02       --------PAQPCF-EWRR-------------------------------
A0A096NTE9_BMF-03       --------PAQPCF-EWRR-------------------------------
A0A2I3HD83_BMF-01       --------PAQPCF-EWRR-------------------------------
A0A1S3EQA2_BMF-01       -----AQQPPEG----HRV-------------------------------
Q8K589_BMF-01           ----LGEQPPEGQFLQHRA-------------------------------
A2AV74_BMF-01           ----LGEQPPEGQFLQHRA-------------------------------
I3MDS9_BMF-01           ----LGEQPPEGQW-QHRA-------------------------------
G3T7Z4_BMF-01           ----LGEQPPEGQW-QHRA-------------------------------
F6X3N6_BMF-01           ----LGEEPPEEQW-EHRA-------------------------------
G3WDQ2_BMF-01           ----LGAEPPEEQW-EHRA-------------------------------
A0A1S3WU31_BMF-01       ----FAEQRREGQW-QQRV-------------------------------
Q96LC9_BMF-06           ----IGEQPPEGQW-QHQA-------------------------------
A0A286XXB0_BMF-02       ----LGEQPPEGQW-QHRA-------------------------------
J9PB65_BMF-01           ----LLEQPPEGQW-QHRA-------------------------------
A0A1U8CPE0_BMF-01       ----LGEQPPEGQW-QHRA-------------------------------
A0A286XXB0_BMF-01       ----LGEQPPEGQW-QHRA-------------------------------
G1SR62_BMF-01           ----LGEQPPEGQW-QHRA-------------------------------
F6TJI0_BMF-01           ----LGEQPPEGQW-QHRA-------------------------------
Q05KI3_BMF-01           ----LGEQPPEGQW-QHRA-------------------------------
W5QFV1_BMF-01           ----LGEQPPEGQW-QHRA-------------------------------
M3WRS0_BMF-01           ----LGEQPPEGHW-QHRA-------------------------------
M3YAD5_BMF-01           ----LGDQPPEGQW-QHRA-------------------------------
A0A2K6FFR1_BMF-01       ----LGEQPAEGQW-QHRA-------------------------------
H0WYH6_BMF-01           ----IGEQPPEGQW-QHRA-------------------------------
A0A096NTE9_BMF-01       ----IGEQPPEGQW-QHRA-------------------------------
A0A2K6L933_BMF-02       ----IGEQPPEGQW-QHRA-------------------------------
A0A096NTE9_BMF-02       ----IGEQPPEGQW-QHRA-------------------------------
A0A2K5MJY6_BMF-02       ----IGEQPPEGQW-QHRA-------------------------------
A0A2K5KGR6_BMF-02       ----IGEQPPEGQW-QHRA-------------------------------
G7PAW6_BMF-02           ----IGEQPPEGQW-QHRA-------------------------------
F7CM09_BMF-02           ----IGEQPPEGQW-QHRA-------------------------------
A0A2K6B5G4_BMF-02       ----IGEQPPEGQW-QHRA-------------------------------
A0A2K6B5G4_BMF-01       ----IGEQPPEGQW-QHRA-------------------------------
A0A2K6B5G4_BMF-04       ----IGEQPPEGQW-QHRA-------------------------------
A0A2K5Z4C3_BMF-01       ----IGEQPPEGQW-QHRA-------------------------------
A0A2K6L933_BMF-03       ----IGEQPPEGQW-QHRA-------------------------------
A0A2K6L933_BMF-01       ----IGEQPPEGQW-QHRA-------------------------------
A0A2K6RAW8_BMF-01       ----IGEQPPEGQW-QHRA-------------------------------
A0A0D9R4R5_BMF-01       ----IGEQPPEGQW-QHRA-------------------------------
F7HPK0_BMF-01           ----LGEQPPEGQW-QHRA-------------------------------
A0A2K5E1W9_BMF-01       ----LGEQPPEGQW-QHRA-------------------------------
A0A2K6TW86_BMF-02       ----LGEQPPEGQW-QHRA-------------------------------
A0A2K6TW86_BMF-01       ----LGEQPPEGQW-QHRA-------------------------------
G3QIN5_BMF-01           ----IGEQPPEGQW-QHRA-------------------------------
Q96LC9_BMF-01           ----IGEQPPEGQW-QHQA-------------------------------
Q96LC9_BMF-02           ----IGEQPPEGQW-QHQA-------------------------------
Q96LC9_BMF-03           ----IGEQPPEGQW-QHQA-------------------------------
Q96LC9_BMF-04           ----IGEQPPEGQW-QHQA-------------------------------
A0A2R9BS98_BMF-01       ----IGEQPPEGQW-QHRA-------------------------------
A0A2J8QDD5_BMF-02       ----IGEQPPEGQW-QHRA-------------------------------
A0A2J8T301_BMF-01       ----TGEQPPEGQW-QHRA-------------------------------
H9GL49_BMF-01           ----FQEEPQESPQ-ELRT-------------------------------
A9XRG9_BMF-01           ----L---------------------------------------------
K7FRX2_BMF-01           ----LQEEPREGHQ-EARA-------------------------------
U3JS06_BMF-01           ----LQEEPQEGQR-EARA-------------------------------
H0ZMX5_BMF-01           ----LQEEPQEGQR-EARA-------------------------------
A9XRG9_BMF-02           ----LQEEPQEGQR-EART-------------------------------
A9XRG9_BMF-03           ----LQEEPQEGQR-EART-------------------------------
G1NHG8_BMF-01           ----LQEEPQEGQR-EART-------------------------------
W5N4P7_BMF-01           ETGEAEEQP------VRSA-------------------------------
I3K2D6_BMF-01           QQNSMERLP-RQRPAARSV-------------------------------
A0A096LRV0_BMF-01       EQNRMEQLP-LHQPAALSL-------------------------------
A0A2U9CJH3_BMF-01       ERSGMEQLPRQQQPVAHSV-------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
F6Z067_BAD-01           --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
F1PUF4_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
A0A1S3FUQ7_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
G1SS60_BAD-01           --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z697_BAD-02       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0C1_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2I3MCN5_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-02       --------------------------------------------------
F7GVS7_BAD-02           --------------------------------------------------
A0A2K6E7J3_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5E6K7_BAD-03       --------------------------------------------------
A0A2K5HKW9_BAD-02       --------------------------------------------------
A0A2K6N1A1_BAD-02       --------------------------------------------------
A0A2K6PUM5_BAD-02       --------------------------------------------------
A0A2K5M0C1_BAD-03       --------------------------------------------------
A0A2K5VCD8_BAD-03       --------------------------------------------------
F7GVS7_BAD-03           --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2I3MCN5_BAD-02       --------------------------------------------------
A0A2K6E7J3_BAD-03       --------------------------------------------------
A0A2I2Z8C7_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z697_BAD-03       --------------------------------------------------
F6SJL0_BAD-02           --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3VRY4_BAD-01           --------------------------------------------------
G3VRY4_BAD-02           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
I3MBM5_BAD-01           --------------------------------------------------
I3MBM5_BAD-02           --------------------------------------------------
A0A091DDU4_BAD-01       --------------------------------------------------
Q61337_BAD-02           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
A0A1U7Q4V0_BAD-01       --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
O35147_BAD-01           --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A1S3FL84_BAD-01       --------------------------------------------------
A0A2K5E6K7_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5M0C1_BAD-01       --------------------------------------------------
A0A2K5VCD8_BAD-01       --------------------------------------------------
F7GVS7_BAD-01           --------------------------------------------------
A0A2K6E7J3_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2I3MCN5_BAD-04       --------------------------------------------------
A0A2K6N1A1_BAD-01       --------------------------------------------------
A0A2K6PUM5_BAD-01       --------------------------------------------------
A0A2K5HKW9_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F6SJL0_BAD-01           --------------------------------------------------
A0A2I3MCN5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z697_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
                                                                          

U3IW89_BCL2L11-01       -----------------------------S----GYFSFEAERSPAPMSC
Q6JTU4_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
A0A0P0HZF9_PMAIP1-      -----------------------------EKTAVVECAQQLRTIGDLF--
Q0GKC8_PMAIP1-01        -----------------------------EQTAVVECAQQLRNIGDLL--
A0A2I3HX97_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
A0A1D5PAR2_PMAIP1-      -----------------------------D--AVAECALELRRIGDKA--
A0A2K6EM90_PMAIP1-      -----------------------------E----EECALQLRRLGDKL--
G1P8F9_PMAIP1-01        -----------------------------E----IECALQLRRIGDKL--
G3T0P7_PMAIP1-01        -----------------------------QQRDVVECAIQLRRIGDKI--
Q1PCT2_PMAIP1-01        -----------------------------E----VECAIQLRKFGDKL--
G1LIZ7_PMAIP1-01        -----------------------------E----VECAIQLRRFGDKL--
A0A2K5NJZ2_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
A0A0D9S003_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
A0A2K5VPX2_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
A0A2K6BV75_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
A0A2K5ZWH1_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
A0A096MPU8_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
A0A2K5JY52_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
A0A2K6KJF2_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
A0A2K6NC45_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
A0A2K6S6C4_PMAIP1-      -----------------------------E----VECAIQLRRFGDKL--
A0A2I2YVQ5_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
Q13794_PMAIP1-01        -----------------------------E----VECATQLRRFGDKL--
A0A2R9AKC9_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
A0A2I3SX38_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
H2NWG2_PMAIP1-01        -----------------------------E----VECATQLRRFGDKL--
A0A2K5CFK7_PMAIP1-      -----------------------------E----VECATQLRRFGDKL--
F7GW45_PMAIP1-01        -----------------------------E----VECATQLRRFGDKL--
A0A337SUX1_PMAIP1-      -----------------------------E----VECAMQLRRFGDKL--
W5P738_PMAIP1-01        -----------------------------E----VECAIQLRRIGDKL--
A0A287AZR7_PMAIP1-      -----------------------------L--PAVKCRIGLRRVGTKL--
G1MV54_BCL2L11-01       -----------------------------Q--PEIWIAQELRRIGDEFNA
G1PDJ5_BCL2L11-01       -----------------------------R--PEMWIAQELRRIGDEFNN
K7E5Y2_BBC3-01          EGEPQGASPMSGGPPGVLGPEHGDQGEQQD----REIGAQLRRMADDLNA
F6RS78_BIK-01           --------------------------------------------------
B2KKY9_BCL2L11-01       -----------------------------E----MVVARELRRIGDEFNR
B8JK68_BCL2L11-01       -----------------------------E----MVVARELRRIGDEFNR
A0A2K6KS56_BBC3-02      --------------------------------------------------
F7G1G0_HRK-01           -----------------------------R----RNL-------------
A0A1U7R468_HRK-01       -----------------------------R----RSA-------------
P62816_HRK-03           -----------------------------R----RSA-------------
P62817_HRK-01           -----------------------------R----RSA-------------
A0A287A5N9_HRK-01       -----------------------------R----RNL-------------
H2NIS8_HRK-01           -----------------------------R----RNL-------------
A0A2K5KZ69_HRK-01       -----------------------------R----RNL-------------
H2Q6Y8_HRK-01           -----------------------------R----RNL-------------
G3UH24_HRK-01           -----------------------------R----RNL-------------
A0A2K5BYA0_HRK-01       -----------------------------R----RNL-------------
G3MWR6_HRK-01           -----------------------------R----RNL-------------
U3E722_HRK-01           -----------------------------R----RNL-------------
A0A0D9SC73_HRK-01       -----------------------------R----RNL-------------
A0A337SQ56_HRK-01       -----------------------------R----RNL-------------
G3QTJ6_HRK-01           -----------------------------R----RNL-------------
O00198_HRK-01           -----------------------------R----RNL-------------
A0A1D5R1E4_HRK-01       -----------------------------R----RNL-------------
A0A2K6AYL7_HRK-01       -----------------------------R----RNL-------------
G1QHD8_HRK-01           -----------------------------R----RNL-------------
G1T7W1_HRK-01           -----------------------------R----RNL-------------
H0Y001_HRK-01           -----------------------------R----RNL-------------
A0A096N944_HRK-01       -----------------------------R----RNL-------------
A0A2K6GL98_HRK-01       -----------------------------R----RNL-------------
E2RLD4_HRK-01           -----------------------------R----RNL-------------
F7GVS7_BAD-04           -----------------------------C----PFLAP-----------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
G3SU55_BCL2L11-01       -----------------------------E----IWIARELRRIGDEFNA
G3W979_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
O43521_BCL2L11-11       -----------------------------Q----PPK-------------
F7HHA9_BCL2L11-08       -----------------------------Q----PPK-------------
A0A1U8BW10_BCL2L11      -----------------------------D----QSKS------------
O54918_BCL2L11-03       -----------------------------D----AWYN------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
A0A2I3HW02_BCL2L11      -----------------------------E----VQWPFEWLAKSS----
A0A2K6TRZ5_BCL2L11      -----------------------------E----VQCPLEWLAKSS----
A0A2K5HZI7_BCL2L11      -----------------------------E----VQ--------------
A0A2K5NU92_BCL2L11      -----------------------------E----VQWPLECLASS-----
A0A2K5Z8B6_BCL2L11      -----------------------------E----VQWPLECLASS-----
A0A2I2YQ13_BCL2L11      -----------------------------E----VQWPLEWLAKSS----
O43521_BCL2L11-23       -----------------------------E----VQWPLKWLAKSS----
A0A2R9CA99_BCL2L11      -----------------------------E----VQWPLKWLAKSS----
A0A2J8JCT2_BCL2L11      -----------------------------E----VQWPLKWLAKSS----
F7HHA9_BCL2L11-07       -----------------------------E----VQWPLEWLA-------
A0A2K5CAB2_BCL2L11      -----------------------------E----VQWPLEWLAKSS----
A0A2K5X2I7_BCL2L11      -----------------------------E----VQWPLEWLASS-----
A0A2I3M6I1_BCL2L11      -----------------------------E----VQWPLEWLASS-----
C1KGB8_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
A0A2K6GE31_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A337SW42_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
O43521_BCL2L11-10       -----------------------------E----IWIAQELRRIGDEFNA
O43521_BCL2L11-20       -----------------------------E----IWIAQELRRIGDEFNA
A0A2I2YQ13_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
O43521_BCL2L11-17       -----------------------------E----IWIAQELRRIGDEFNA
O43521_BCL2L11-13       -----------------------------E----IWIAQELRRIGDEFNA
A0A2I3HW02_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2R9CA99_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2J8JCT2_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2K5NU92_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5X2I7_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
F7HHA9_BCL2L11-05       -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5Z8B6_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5HZI7_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6KJP8_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6QIL2_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5CAB2_BCL2L11      -----------------------------F----IFTFFDLYG-------
A0A2K5Z8B6_BCL2L11      -----------------------------F----IFTGLDLYG-------
A0A2K6KJP8_BCL2L11      -----------------------------F----IFTGLDLYVV------
A0A2K6QIL2_BCL2L11      -----------------------------F----IFTGLDLYVV------
F6XMC1_BCL2L11-09       -----------------------------F----TFTFFDLCG-------
A0A2K6TRZ5_BCL2L11      -----------------------------F----IFTFFDLYG-------
A0A2K5HZI7_BCL2L11      -----------------------------F----IFTGLDLYG-------
A0A2R9CA99_BCL2L11      -----------------------------F----IFTGLDLYG-------
A0A2J8JCT2_BCL2L11      -----------------------------F----IFTGLDLYG-------
A0A2K5NU92_BCL2L11      -----------------------------F----IFTGLDLYG-------
A0A2K5X2I7_BCL2L11      -----------------------------F----IFTGLDLYG-------
F7HHA9_BCL2L11-09       -----------------------------F----IFTGLDLYG-------
A0A2K6E226_BCL2L11      -----------------------------F----IFTGLDLYG-------
A0A2I3M6I1_BCL2L11      -----------------------------F----IFTGLDLYG-------
A0A2I2YQ13_BCL2L11      -----------------------------F----IFTGLDLYG-------
O43521_BCL2L11-06       -----------------------------F----IFTGLDLYG-------
O43521_BCL2L11-15       -----------------------------F----IFTGLDLYG-------
A0A2I3HW02_BCL2L11      -----------------------------F----IFTGLDLYG-------
F1SU81_BCL2L11-03       -----------------------------E----IWIAQELRRIGDEFNA
A0A0D9RWE0_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
O43521_BCL2L11-05       -----------------------------E----IWIAQELRRIGDEFNA
O43521_BCL2L11-25       -----------------------------E----IWIAQELRRIGDEFNA
O54918_BCL2L11-08       -----------------------------E----IRIAQELRRIGDEFNE
O54918_BCL2L11-06       -----------------------------E----IRIAQELRRIGDEFNE
A0A1U8BW10_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNE
Q2YDF0_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
A0A287DFJ0_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNL
O54918_BCL2L11-05       -----------------------------E----IRIAQELRRIGDEFNE
O88498_BCL2L11-02       -----------------------------E----IRIAQELRRIGDEFNE
A0A2K6GE31_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2K5CAB2_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2K6TRZ5_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2K6QIL2_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5NU92_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5HZI7_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5X2I7_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6E226_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5Z8B6_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2I3M6I1_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2I3M6I1_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6KJP8_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2I2YQ13_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
O43521_BCL2L11-02       -----------------------------E----IWIAQELRRIGDEFNA
A0A2R9CA99_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2J8JCT2_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
H2P5E2_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
A0A337SW42_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A286XJN2_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A1S3FHA8_BCL2L11      -----------------------------E----IWIAQELRRIGDEFDA
Q4KMV9_BCL2L11-01       -----------------------------E----LWIAQELRRIGDDFNA
F7FTC8_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
A0A2K6E226_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
M3YDI3_BCL2L11-01       -----------------------------E----MWIAQELRRIGDEFNA
F6XMC1_BCL2L11-02       -----------------------------E----IWIAQELRRIGDEFNA
F6XMC1_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
F7CXT2_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
F6XMC1_BCL2L11-08       -----------------------------R----GIGEKQEERVNPHTWE
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       -----------------------------E----IRIAQELRRIGDEFNE
O88498_BCL2L11-01       -----------------------------E----IRIAQELRRIGDEFNE
A0A1U8BW10_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNE
A0A287DFJ0_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNL
A0A2K6GE31_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2K6GE31_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2K5CAB2_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
F6XMC1_BCL2L11-07       -----------------------------E----IWIAQELRRIGDEFNA
A0A2K6TRZ5_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
F6XMC1_BCL2L11-05       -----------------------------E----IWIAQELRRIGDEFNA
A0A2K6TRZ5_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2K5CAB2_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2K5NU92_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5HZI7_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5X2I7_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
F7HHA9_BCL2L11-02       -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6E226_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5Z8B6_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2I3M6I1_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6KJP8_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6QIL2_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2I2YQ13_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
O43521_BCL2L11-16       -----------------------------E----IWIAQELRRIGDEFNA
O43521_BCL2L11-09       -----------------------------E----IWIAQELRRIGDEFNA
A0A2R9CA99_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2J8JCT2_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2K5NU92_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5HZI7_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5X2I7_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
F7HHA9_BCL2L11-04       -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6E226_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5Z8B6_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2I3M6I1_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6KJP8_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6QIL2_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2I2YQ13_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
O43521_BCL2L11-18       -----------------------------E----IWIAQELRRIGDEFNA
A0A2I3HW02_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2R9CA99_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2J8JCT2_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2K5CAB2_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2K5CAB2_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
F6XMC1_BCL2L11-03       -----------------------------E----IWIAQELRRIGDEFNA
A0A2K6TRZ5_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2K6TRZ5_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2K6QIL2_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6QIL2_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5NU92_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5HZI7_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5X2I7_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6E226_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6E226_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K5Z8B6_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2I3M6I1_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6KJP8_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2K6KJP8_BCL2L11      -----------------------------E----IRIAQELRRIGDEFNA
A0A2I2YQ13_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
O43521_BCL2L11-03       -----------------------------E----IWIAQELRRIGDEFNA
A0A2I3HW02_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2R9CA99_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A2J8JCT2_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
F1SU81_BCL2L11-02       -----------------------------E----IWIAQELRRIGDEFNA
A0A337SW42_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
W5PY58_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
F7A7D2_BCL2L11-01       -----------------------------E----VWIAQELRRIGDEFNA
A0A286XJN2_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
A0A286XJN2_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
G1SSY0_BCL2L11-01       -----------------------------E----TWIAQELRRIGDEFNA
H0XW23_BCL2L11-01       -----------------------------E----MWIAQELRRIGDEFNA
A0A1S3FHA8_BCL2L11      -----------------------------E----IWIAQELRRIGDEFDA
A0A337SW42_BCL2L11      -----------------------------E----IWIAQELRRIGDEFNA
G1LDR8_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
J9NWV6_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
F1SU81_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
A0A286XF37_PMAIP1-      -----------------------------E----VECAAQLRRIGDKLNF
A0A1U7QLK6_PMAIP1-      -----------------------------E----DECVHQLRRIGDKQNL
Q9JM54_PMAIP1-01        -----------------------------K----DEC-AQLRRIGDKVNL
Q5U777_PMAIP1-01        -----------------------------K----DEC-DQLRRIGDKVNL
I3LVX0_BIK-01           -----------------------------Q----ARVTGVLRSLAQGLAS
A9XRH0_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
R4G9R5_BCL2L11-01       -----------------------------E----IWIAQELRRIGDEFNA
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
O61667_EGL1-01          -----------------------------G----YEIGSKLAAMCDDFDA
A3KND0_BMF-01           ---------------------------------------ALSEIYRMFNA
A0A2K5F6X4_BBC3-02      -----------------------------A----REIGAQLRRMADDLNA
A0A337SQV0_BBC3-03      -----------------------------A----REIGAQLRRMADDLNA
F1SMU1_PMAIP1-01        -----------------------------E----VECAIQFRRIGDKLNF
Q9BXH1_BBC3-04          --------------------------------------------AGDFLC
K7E5Y2_BBC3-02          -----------------------------D----REIGAQLRRMADDLNA
F7CQN5_BBC3-01          -----------------------------A----REIGAQLRRMADDLNA
A0A2I3HWI8_BBC3-03      -----------------------------A----REIGAQLRRMADDLNA
A0A2K6FQZ3_BBC3-04      -----------------------------A----REIGAQLRRMADDLNA
Q9BXH1_BBC3-05          -----------------------------A----REIGAQLRRMADDLNA
A0A2R9BZA9_BBC3-01      -----------------------------A----REIGAQLRRMADDLNA
A0A2I3RGH5_BBC3-03      -----------------------------A----REIGAQLRRMADDLNA
A0A2K5P2T8_BBC3-03      -----------------------------A----REIGAQLRRMADDLNA
A0A2K5V8J3_BBC3-03      -----------------------------A----REIGAQLRRMADDLNA
F7FFP6_BBC3-03          -----------------------------A----REIGAQLRRMADDLNA
A0A2K6ASP2_BBC3-03      -----------------------------A----REIGAQLRRMADDLNA
A0A2I3N2Z9_BBC3-03      -----------------------------A----REIGAQLRRMADDLNA
A0A2K6QZU4_BBC3-04      -----------------------------A----REIGAQLRRMADDLNA
A0A2R8MW85_BBC3-03      -----------------------------A----REIGAQLRRMADDLNA
A0A2K6STD6_BBC3-02      -----------------------------A----REIGAQLRRMADDLNA
G3T2N1_BBC3-01          -----------------------------A----REIGAQFRRKADDLYA
M3Y0R3_BBC3-01          -----------------------------A----REIGAQLRRMADDLNA
A0A1U7R5N5_BBC3-01      -----------------------------A----REIGAQLRRMADDLNA
Q99ML1_BBC3-02          -----------------------------A----REIGAQLRRMADDLNA
Q80ZG6_BBC3-01          -----------------------------A----REIGAQLRRMADDLNA
H0XQ00_BBC3-01          -----------------------------A----REIGAQLRRMADDLNA
J9NTK9_BBC3-01          -----------------------------A----REIGAQLRRMADDLNA
A0A337SQV0_BBC3-02      -----------------------------A----REIGAQLRRMADDLNA
F1RM01_BBC3-01          -----------------------------A----REIGAQLRRMADDLNA
A0A2K6FQZ3_BBC3-01      -----------------------------A----REIGAQLRRMADDLNA
Q9BXH1_BBC3-06          -----------------------------A----REIGAQLRRMADDLNA
A0A2I3RIG5_BBC3-02      -----------------------------A----REIGAQLRRMADDLNA
H2NZD3_BBC3-01          -----------------------------A----REIGAQLRRMADDLNA
A0A2K6QZU4_BBC3-01      -----------------------------A----REIGAQLRRMADDLNA
A0A0D9S2H2_BBC3-01      -----------------------------A----QEIGAQLRRMADDLNA
B4DQK3_BBC3-01          -----------------------------A----REIGAQLRRMADDLNA
F6TGJ4_BMF-01           -----------------------------E----HRIARKLQCIGDQFHR
G1PAU1_BMF-01           -----------------------------E----IQIARKLQSIADQFHR
A0A1U8CPE0_BMF-02       -----------------------------E----VQIARKLQCIADQFHR
A0A286XXB0_BMF-03       -----------------------------E----VQIARKLQCIADQFHR
I3MDS9_BMF-02           -----------------------------E----VQIARKLQCIADQFHR
A0A287AIU8_BMF-05       -----------------------------E----VQIARKLQCIADQFHR
A0A287AIU8_BMF-03       -----------------------------E----VQIARKLQCIADQFHR
A0A287AIU8_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
A0A287AIU8_BMF-02       -----------------------------E----VQIARKLQCIADQFHR
A0A287AIU8_BMF-04       -----------------------------E----VQIARKLQCIADQFHR
A0A1S3EQA2_BMF-02       -----------------------------E----VQIARKLQCIADQFHR
A2AV74_BMF-02           -----------------------------E----VQIARKLQCIADQFHR
A0A337SQV0_BBC3-01      APGIAGAQRPGGPGGRPHPGSPGSPGGGGA----VGPGDRGPAAADGGRP
Q9BXH1_BBC3-03          APGVARAQRPGGSGGRSHPGGPGSPRGGGT----VGPGDRGPAAADGGRP
A0A2K5KGR6_BMF-01       -----------------------------E----QERGGPQVRLGCPLHM
A0A2K6FFR1_BMF-02       -----------------------------E----QERGRSQ---------
M3WRS0_BMF-02           -----------------------------E----QEWGRSQ---------
A0A2K5E1W9_BMF-02       -----------------------------E----QEWGRPE---------
F7HPK0_BMF-02           -----------------------------E----QEWGRPE---------
A0A2K6TW86_BMF-03       -----------------------------K----QEWGRSE---------
A0A2K6RAW8_BMF-02       -----------------------------E--------------------
G3QIN5_BMF-02           -----------------------------E----QERGRP----------
Q96LC9_BMF-07           -----------------------------E----QERGRP----------
Q96LC9_BMF-05           -----------------------------E----QERGRP----------
A0A2R9BS98_BMF-02       -----------------------------E----QERGRP----------
A0A2J8QDD5_BMF-01       -----------------------------E----QERGRP----------
A0A2K5MJY6_BMF-01       -----------------------------E----QERGGP----------
G7PAW6_BMF-01           -----------------------------E----QERGGP----------
A0A2K6B5G4_BMF-03       -----------------------------E----QERGGP----------
A0A2K5Z4C3_BMF-02       -----------------------------E----QERGGP----------
A0A096NTE9_BMF-03       -----------------------------E----QERGGP----------
A0A2I3HD83_BMF-01       -----------------------------E----QEWGRP----------
A0A1S3EQA2_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
Q8K589_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
A2AV74_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
I3MDS9_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
G3T7Z4_BMF-01           -----------------------------E----VQIARKLQCIADHFHR
F6X3N6_BMF-01           -----------------------------E----VQIAQKLQCIADQFHR
G3WDQ2_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
A0A1S3WU31_BMF-01       -----------------------------E----VQIARKLQCIADQFHH
Q96LC9_BMF-06           -----------------------------E--------------------
A0A286XXB0_BMF-02       -----------------------------E----VQIARKLQCIADQFHR
J9PB65_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
A0A1U8CPE0_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
A0A286XXB0_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
G1SR62_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
F6TJI0_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
Q05KI3_BMF-01           -----------------------------E----IQIARKLQCIADQFHR
W5QFV1_BMF-01           -----------------------------E----IQIARKLQCIADQFHR
M3WRS0_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
M3YAD5_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
A0A2K6FFR1_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
H0WYH6_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
A0A096NTE9_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
A0A2K6L933_BMF-02       -----------------------------E----VQIARKLQCIADQFHR
A0A096NTE9_BMF-02       -----------------------------E----VQIARKLQCIADQFHR
A0A2K5MJY6_BMF-02       -----------------------------E----VQIARKLQCIADQFHR
A0A2K5KGR6_BMF-02       -----------------------------E----VQIARKLQCIADQFHR
G7PAW6_BMF-02           -----------------------------E----VQIARKLQCIADQFHR
F7CM09_BMF-02           -----------------------------E----VQIARKLQCIADQFHR
A0A2K6B5G4_BMF-02       -----------------------------E----VQIARKLQCIADQFHR
A0A2K6B5G4_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
A0A2K6B5G4_BMF-04       -----------------------------E----VQIARKLQCIADQFHR
A0A2K5Z4C3_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
A0A2K6L933_BMF-03       -----------------------------E----VQIARKLQCIADQFHR
A0A2K6L933_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
A0A2K6RAW8_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
A0A0D9R4R5_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
F7HPK0_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
A0A2K5E1W9_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
A0A2K6TW86_BMF-02       -----------------------------E----VQIARKLQCIADQFHR
A0A2K6TW86_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
G3QIN5_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
Q96LC9_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
Q96LC9_BMF-02           -----------------------------E----VQIARKLQCIADQFHR
Q96LC9_BMF-03           -----------------------------E----VQIARKLQCIADQFHR
Q96LC9_BMF-04           -----------------------------E----VQIARKLQCIADQFHR
A0A2R9BS98_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
A0A2J8QDD5_BMF-02       -----------------------------E----VQIARKLQCIADQFHR
A0A2J8T301_BMF-01       -----------------------------E----VQIARKLQCIADQFHR
H9GL49_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
A9XRG9_BMF-01           --------------------------------------------------
K7FRX2_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
U3JS06_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
H0ZMX5_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
A9XRG9_BMF-02           -----------------------------E----VQIARKLQCIADQFHR
A9XRG9_BMF-03           -----------------------------E----VQIARKLQCIADQFHR
G1NHG8_BMF-01           -----------------------------E----VQIARKLQCIADQFHR
W5N4P7_BMF-01           -----------------------------E----VRIGQKLQRIGDQFHR
I3K2D6_BMF-01           -----------------------------E----ACIGQKLQLIGDQFHW
A0A096LRV0_BMF-01       -----------------------------E----ACIGQKLQLIGDQFHR
A0A2U9CJH3_BMF-01       -----------------------------E----ACIGQKLQLIGDQFHR
Q0GKC7_BMF-01           -----------------------------E----TLIGQKLQLIGDQFYQ
A0A2K5JY52_PMAIP1-      -----------------------------S----DSQTLLLRNLTATKTC
A0A096MPU8_PMAIP1-      -----------------------------S----DSQTLLLRNLTASKTC
A0A2K5ZWH1_PMAIP1-      -----------------------------S----DSQTLLLRNLTASKTC
A0A2K5VPX2_PMAIP1-      -----------------------------S----DSQTLLLRNLTASKTC
A0A2K6BV75_PMAIP1-      -----------------------------S----DSQTLLLRNLTASKTC
A0A2K6KJF2_PMAIP1-      -----------------------------S----DSQTLLLRNLTASKTC
A0A2K6NC45_PMAIP1-      -----------------------------S----DSQTLLLRNLTASKTC
Q13794_PMAIP1-02        -----------------------------S----DIQTLLLRNLTASKTC
A0A2R9AKC9_PMAIP1-      -----------------------------S----DIQTLLLRNLTASKTC
A0A1D5QGJ8_PMAIP1-      -----------------------------S----DSQTLLLRNLTASKTC
A0A2I2YVQ5_PMAIP1-      -----------------------------S----DIQTLLLRNLTASKTC
A0A2I3SX38_PMAIP1-      -----------------------------S----DIQTLLLRNLTASKTC
C1C3S9_BAD-01           -----------------------------T----EMTVSKSFGETFFNFF
F6Z067_BAD-01           -----------------------------G----QMTGNRSIRDLIMGLF
M3XHJ5_BCL2L11-01       -----------------------------T----QTPSPSSQLIVHVQHC
W5QCU2_BIK-01           -----------------------------S------LWPELALSLLVVAM
O70337_BIK-04           -----------------------------D----QDPGQLFPMVLLVFLL
O70337_BIK-02           -----------------------------D----QDPGQLFPMVLLVFLL
O70337_BIK-01           -----------------------------D----QDPGQLFPMVLLVFLL
Q925D2_BIK-01           -----------------------------D----QDPGQLFPMVLLVFLL
G1TZR9_BIK-01           -----------------------------R----PLPGQGWPPSWRVVLL
F1PUF4_BIK-01           -----------------------------N----PGRGLVLSLLLLLVLL
H0XAE7_BIK-01           -----------------------------A----PAWEQVLLLLLLLVLL
A0A2K6FM79_BIK-01       -----------------------------A----PAWEQVLLLLLVL-LL
A0A1S3FUQ7_BIK-01       -----------------------------G----QVRRQMLPAVL----L
H0W025_BIK-01           -----------------------------R----WTCRWLLPVLLLLLLL
A0A2K5CLG5_BIK-01       -----------------------------K----QAVL--LALLALLLAM
F7FUT7_BIK-01           -----------------------------K----QAVL--LALLALLLAM
A0A2K6TBD7_BIK-01       -----------------------------K----QAVL--LALLALLLAM
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           -----------------------------E----QMLLVLLVLLLLLLPL
G3QCT2_BIK-01           -----------------------------E----QVLLALLLLLALLLPL
A0A2R8ZXD2_BIK-01       -----------------------------E----QVLLALLLLLALLLPL
H2QLU7_BIK-01           -----------------------------E----QVLLALLLLLALLLPL
Q13323_BIK-01           -----------------------------E----QVLLALLLLLALLLPL
A0A2K6MCW0_BIK-01       -----------------------------E----QVLLALLLLLA---AL
A0A2K6QK74_BIK-01       -----------------------------E----QVLLALLLLLA---AL
A0A0D9QZY8_BIK-01       -----------------------------E----QVLLALL-LLALLLAL
A0A2K5VW94_BIK-01       -----------------------------E----QVLLVLLLLLALLLAL
A0A2K6DBJ4_BIK-01       -----------------------------E----QVLLVLLLLLALLLAL
A0A2K5J4Q7_BIK-01       -----------------------------E----QVLLALLLLLALLLAL
A0A096NKG5_BIK-01       -----------------------------E----QVLLALLLLLALLLAL
A0A2K5LDM6_BIK-01       -----------------------------E----QVLL----LLALLLAL
A0A2K5XSA1_BIK-01       -----------------------------E----QVLL----LLALLLAL
I3K7B6_BAD-01           -----------------------------A----KKYGQKLRRMSDEFDS
B5X1T1_BAD-01           -----------------------------A----KKYGRQLRRMSDEFDT
Q4V925_BAD-02           -----------------------------A----KKYGQQLRRMSDEF--
Q4V925_BAD-03           -----------------------------A----KKYGQQLRRMSDEF--
A7MCM4_BAD-01           -----------------------------A----KKYGQQLRRMSDEF--
Q4V925_BAD-04           -----------------------------A----KKYGQQLRRMSDEF--
Q4V925_BAD-01           -----------------------------A----KKYGQQLRRMSDEF--
G3Q8B3_BAD-01           -----------------------------A----KKYGRQLRRMSDEFDS
A0A087X8P8_BAD-01       -----------------------------A----KKYGRQLRRMSDEFVN
E7FBJ6_BAD-01           -----------------------------A----KKYGRQLRRMSDEFDT
B5XEF1_BAD-01           -----------------------------A----KKYGCQLRRMSDEFDT
G1SS60_BAD-01           -----------------------------A----QRYGRELRRMSDEFEG
Q9GL49_PMAIP1-01        -----------------------------A----EMPGRRSRRNTQTNPT
H3D8J8_BAD-01           -----------------------------A----KKYGRQLRRMSDEFDS
H3ANP3_BAD-03           -----------------------------A----RKYGQELRRMSDEFDM
H3ANP3_BAD-04           -----------------------------A----RKYGQELRRMSDEFDM
H3ANP3_BAD-01           -----------------------------A----RKYGQELRRMSDEFDM
H3ANP3_BAD-02           -----------------------------A----RKYGQELRRMSDEFDM
A0A337SAW2_BAD-01       -----------------------------A----LRYGRELRRMSDEFQG
A0A2U9BAC9_BAD-01       -----------------------------A----MKYGQKLRRMSDEFDS
A0A2I3TBK7_BAD-01       ---------------------------------------KLRPLPVTFAP
A0A2R8Z697_BAD-02       ---------------------------------------KLRPLPVTFAP
A0A2I2Z8C7_BAD-03       ---------------------------------------KLRPLPVTFAA
Q92934_BAD-03           ---------------------------------------KLRPLPVTFAP
A0A2K5M0C1_BAD-02       ---------------------------------------KLRPLPVTFAP
A0A2K5XJR2_BAD-02       ---------------------------------------KLRPLPVTFAP
A0A2I3MCN5_BAD-03       ---------------------------------------KLRPLPVTFAP
A0A2K5VCD8_BAD-02       ---------------------------------------KLRTLPVTFAP
F7GVS7_BAD-02           ---------------------------------------KLRTLPVTFAP
A0A2K6E7J3_BAD-02       ---------------------------------------KLRTLPVTFAP
A0A2K5E6K7_BAD-02       ---------------------------------------RLRSLPVTFAP
A0A2K6TG62_BAD-02       ---------------------------------------RLRSLPVTFAP
A0A2K5E6K7_BAD-03       -------------------------------------NVKLE-VPC-W--
A0A2K5HKW9_BAD-02       -------------------------------------NVKLEALGL-WRP
A0A2K6N1A1_BAD-02       -------------------------------------NVKLEALGL-WRP
A0A2K6PUM5_BAD-02       -------------------------------------NVKLEALGL-WRP
A0A2K5M0C1_BAD-03       -------------------------------------NVKLKALGL-WRP
A0A2K5VCD8_BAD-03       -------------------------------------NVKLKALGL-WRP
F7GVS7_BAD-03           -------------------------------------NVKLKALGL-WRP
A0A2K5XJR2_BAD-03       -------------------------------------NVKLKALGL-WRP
A0A2I3MCN5_BAD-02       -------------------------------------NVKLKALGL-WRR
A0A2K6E7J3_BAD-03       -------------------------------------NVKLKALGL-WRP
A0A2I2Z8C7_BAD-04       -------------------------------------NVKLEALGL-WRS
Q92934_BAD-04           -------------------------------------NVKLEALGL-WRS
A0A2I3TBK7_BAD-03       -------------------------------------NVKLEALGL-WRS
A0A2R8Z697_BAD-03       -------------------------------------NVKLEALGL-WRS
F6SJL0_BAD-02           -------------------------------------NVKLEALGL-WRP
A0A2K6TG62_BAD-03       -------------------------------------NVKLEALEP-WRH
G1P8C5_BAD-01           -----------------------------A----QRYGRELRRMSDEFQG
W5P8G9_BAD-01           -----------------------------A----QRYGRELRRMSDEFHV
G3VRY4_BAD-01           -----------------------------A----RHYGSELRRMSDEFHC
G3VRY4_BAD-02           -----------------------------A----RHYGSELRRMSDEFHC
G3TP47_BAD-01           -----------------------------A----QRYGRELRRMSDEFQG
I3MBM5_BAD-01           -----------------------------A----QRYGRELRRMSDEFEG
I3MBM5_BAD-02           -----------------------------A----QRYGRELRRMSDEFEG
A0A091DDU4_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
Q61337_BAD-02           -----------------------------A----QRYGRELRRMSDEFEG
Q61337_BAD-03           -----------------------------A----QRYGRELRRMSDEFEG
A0A1U7Q4V0_BAD-01       -----------------------------A----QRYGRELRRMSDEFEG
Q61337_BAD-01           -----------------------------A----QRYGRELRRMSDEFEG
G1MI17_BAD-01           -----------------------------A----LRYGRELRRMSDEFQG
A0A287AEF3_BAD-01       -----------------------------A----QRYGRELRRMSDEFQG
O35147_BAD-01           -----------------------------A----QRYGRELRRMSDEFEG
M3YNE7_BAD-01           -----------------------------A----LRYGRELRRMSDEFQG
F1MUT9_BAD-01           -----------------------------A----QRYGRELRRMSDEFHV
Q3SYZ0_BAD-01           -----------------------------A----QRYGRELRRMSDEFHV
F7DN67_BAD-01           -----------------------------A----RRYGRELRRMSDEFQV
H0WVR2_BAD-01           -----------------------------A----QRYGRELRRMSDEFED
H0V608_BAD-01           -----------------------------A----QRYGRELRRMSDEFVD
A0A1S3FL84_BAD-01       -----------------------------A----RRYGRELRRMSDEFDG
A0A2K5E6K7_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
A0A2K6TG62_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
A0A0D9R491_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
A0A2K5M0C1_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
A0A2K5VCD8_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
F7GVS7_BAD-01           -----------------------------A----QRYGRELRRMSDEFVD
A0A2K6E7J3_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
A0A2K5XJR2_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
A0A2I3MCN5_BAD-04       -----------------------------A----QRYGRELRRMSDEFVD
A0A2K6N1A1_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
A0A2K6PUM5_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
A0A2K5HKW9_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
B4DZQ9_BAD-01           -----------------------------A----QRYGRELRRMSDEFVD
A0A2K6GWV0_BAD-01       -----------------------------A----QRYGRELRRMSDEFED
F6SJL0_BAD-01           -----------------------------A----QRYGRELRRMSDEFVD
A0A2I3MCN5_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
A0A2I2Z8C7_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
A0A2I2Z8C7_BAD-02       -----------------------------A----QRYGRELRRMSDEFVD
Q92934_BAD-01           -----------------------------A----QRYGRELRRMSDEFVD
Q92934_BAD-02           -----------------------------A----QRYGRELRRMSDEFVD
A0A2I3TBK7_BAD-02       -----------------------------A----QRYGRELRRMSDEFVD
A0A2R8Z697_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
A0A2J8TYJ3_BAD-01       -----------------------------A----QRYGRELRRMSDEFVD
F1PK10_BAD-01           -----------------------------A----RRYGRELRRMSDEFQG
Q45KI9_BAD-01           -----------------------------A----RRYGRELRRMSDEFQG
                                                                          

U3IW89_BCL2L11-01       DKATQTPSPPCQAVSH----------------------------------
Q6JTU4_BCL2L11-01       YYARRLEK------------------------------------------
A0A0P0HZF9_PMAIP1-      ---------------------DWKYKLLEIIIALQKAQTDGKR-------
Q0GKC8_PMAIP1-01        ---------------------NWKYKLLELIVTLQKIQMEGKR-------
A0A2I3HX97_PMAIP1-      ---------------------NFRQKLLNLISKLFCSGT-----------
A0A1D5PAR2_PMAIP1-      ---------------------DLQQKVLNLITKLFCPKT-----------
A0A2K6EM90_PMAIP1-      ---------------------HFQQKLLNLIAKLFRSGT-----------
G1P8F9_PMAIP1-01        ---------------------SFLQKLLNLMYKLFGSGT-----------
G3T0P7_PMAIP1-01        ---------------------NFRQKLLNVICKLFCSGT-----------
Q1PCT2_PMAIP1-01        ---------------------NFRQKLLNLLSKLFRSGT-----------
G1LIZ7_PMAIP1-01        ---------------------NFRQKLLNLISKLFRSGT-----------
A0A2K5NJZ2_PMAIP1-      ---------------------NFRQKLLNLIAKLFCSGT-----------
A0A0D9S003_PMAIP1-      ---------------------NFRQKLLNLIAKLFCSGT-----------
A0A2K5VPX2_PMAIP1-      ---------------------NFRQKLLNLIAKLFCSGT-----------
A0A2K6BV75_PMAIP1-      ---------------------NFRQKLLNLIAKLFCSGT-----------
A0A2K5ZWH1_PMAIP1-      ---------------------NFRQKLLNLIAKLFCSGT-----------
A0A096MPU8_PMAIP1-      ---------------------NFRQKLLNLIAKLFCSGT-----------
A0A2K5JY52_PMAIP1-      ---------------------NFRQKLLNLIAKLFCSGT-----------
A0A2K6KJF2_PMAIP1-      ---------------------NFRQKLLNLIAKLFCSGT-----------
A0A2K6NC45_PMAIP1-      ---------------------NFRQKLLNLIAKLFCSGT-----------
A0A2K6S6C4_PMAIP1-      ---------------------NFRQKLLNLISKLFCSGT-----------
A0A2I2YVQ5_PMAIP1-      ---------------------NFRQKLLNLISKLFCSGT-----------
Q13794_PMAIP1-01        ---------------------NFRQKLLNLISKLFCSGT-----------
A0A2R9AKC9_PMAIP1-      ---------------------NFRQKLLNLISKLFCSGT-----------
A0A2I3SX38_PMAIP1-      ---------------------NFRQKLLNLISKLFCSGT-----------
H2NWG2_PMAIP1-01        ---------------------NFRQKLLNLISKLFCSGT-----------
A0A2K5CFK7_PMAIP1-      ---------------------NFRQKLLNLISKLFCSGT-----------
F7GW45_PMAIP1-01        ---------------------NFRQKLLNLISKLFCSGT-----------
A0A337SUX1_PMAIP1-      ---------------------NFRQKLMNLISKLFRSGT-----------
W5P738_PMAIP1-01        ---------------------NFRQKLVNLIAKLLRSGT-----------
A0A287AZR7_PMAIP1-      ---------------------AIRQQITNFIIFFFFLGP-----------
G1MV54_BCL2L11-01       SY-CPRRGFLDNH---AGNPQVVILRLLHYIIRLIWRMQ-----------
G1PDJ5_BCL2L11-01       SYRNPRRDFLNVYREAEGHPQMVVLRLLRYILRLVWRRM-----------
K7E5Y2_BBC3-01          LYEQR-----RREEEQRRHL-SPWRLLYNLISGLLAPQRRNRMPDVEPN-
F6RS78_BIK-01           --------------------------------------------------
B2KKY9_BCL2L11-01       LYCEAGAGVNQLRAPNEHAI-VLWMNVIIGRLVHFFLRRR----------
B8JK68_BCL2L11-01       LYCEAGAGVNQLHAPNEHAI-VLWMNDIIGRLVHFFLRRR----------
A0A2K6KS56_BBC3-02      --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
G3MWR6_HRK-01           --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       SYCPRRGFLDNQAI--------NHQIVLRLLHYIIRLIWRMQ--------
G3SU55_BCL2L11-01       YYPRRAFL-NNYQAAEDH----PQMVILRLLRYIVRLVWR----------
G3W979_BCL2L11-01       SYPRRGFLDNNYQAADDH----HQMVILRLLHYIIRLVWRMQ--------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       YYPRRVMLFSLPPFSPHTL---PPPYI-----------------------
A0A2K6GE31_BCL2L11      YYPRRLAKCLVPSI------------------------------------
A0A337SW42_BCL2L11      YYPRRLARVPASYI------------------------------------
O43521_BCL2L11-10       YYARRMPLPPD---------------------------------------
O43521_BCL2L11-20       YYARRMPLPPD---------------------------------------
A0A2I2YQ13_BCL2L11      YYARRLAKLLASST------------------------------------
O43521_BCL2L11-17       YYARRLAKLLASST------------------------------------
O43521_BCL2L11-13       YYARRLAKLLASST------------------------------------
A0A2I3HW02_BCL2L11      YYARRLAKLLASST------------------------------------
A0A2R9CA99_BCL2L11      YYARRLAKLLSST-------------------------------------
A0A2J8JCT2_BCL2L11      YYARRLAKLLASST------------------------------------
A0A2K5NU92_BCL2L11      YYARRLAELLASST------------------------------------
A0A2K5X2I7_BCL2L11      YYARRLAELLASST------------------------------------
F7HHA9_BCL2L11-05       YYARRLAELLASST------------------------------------
A0A2K5Z8B6_BCL2L11      YYARRLAELLASST------------------------------------
A0A2K5HZI7_BCL2L11      YYARRLAKLLASST------------------------------------
A0A2K6KJP8_BCL2L11      YYARRLAKLLASST------------------------------------
A0A2K6QIL2_BCL2L11      YYARRLAKLLASST------------------------------------
A0A2K5CAB2_BCL2L11      ------------HHHSQGT---EQLHHKYFS-------------------
A0A2K5Z8B6_BCL2L11      ------------HHHSQDT---EQLNHKDFS-------------------
A0A2K6KJP8_BCL2L11      --------WIYIYHHSQDT---EQLNHRDFS-------------------
A0A2K6QIL2_BCL2L11      --------WIYIYHHSQDT---EQLNHRDFS-------------------
F6XMC1_BCL2L11-09       ------------HHHSQGT---EQQHKDFSW-------------------
A0A2K6TRZ5_BCL2L11      ------------YHHSQGT---EQLHHKYVS-------------------
A0A2K5HZI7_BCL2L11      ------------HHHSQDT---EQLNHRDFS-------------------
A0A2R9CA99_BCL2L11      ------------HHHSQDA---EQLNHKDFS-------------------
A0A2J8JCT2_BCL2L11      ------------HHHSQDA---EQLNHKDFS-------------------
A0A2K5NU92_BCL2L11      ------------HHHSQDT---EQLNHKDFS-------------------
A0A2K5X2I7_BCL2L11      ------------HHHSQDT---EQLNHKDFS-------------------
F7HHA9_BCL2L11-09       ------------HHHSQDT---EQLNHKDFS-------------------
A0A2K6E226_BCL2L11      ------------HHHSQDT---EQLNHKDFS-------------------
A0A2I3M6I1_BCL2L11      ------------HHHSQDT---EQLNHKDFS-------------------
A0A2I2YQ13_BCL2L11      ------------HHHSQDT---EQLNHKDFS-------------------
O43521_BCL2L11-06       ------------HHHSQDT---EQLNHKDFS-------------------
O43521_BCL2L11-15       ------------HHHSQDT---EQLNHKDFS-------------------
A0A2I3HW02_BCL2L11      ------------HHHSQDT---EQFNHKDFS-------------------
F1SU81_BCL2L11-03       YYPRRVMLFSLPPFSPHTL---PPPYI-----------------------
A0A0D9RWE0_BCL2L11      YYARRLEK------------------------------------------
O43521_BCL2L11-05       YYARRLEK------------------------------------------
O43521_BCL2L11-25       YYARRLEK------------------------------------------
O54918_BCL2L11-08       TYTRRV--FANDYREAEDH---PQMVILQLLRFIFRLVWRRH--------
O54918_BCL2L11-06       TYTRRV--FANDYREAEDH---PQMVILQLLRFIFRLVWRRH--------
A0A1U8BW10_BCL2L11      SYRRRVNNYQEDEDH-PHH---PQMVILQLLRFIVRLVWRRH--------
Q2YDF0_BCL2L11-01       YYPRRV--FVRHQAV-EGH---PQMVLLRVLRYIVRLVWRMQ--------
A0A287DFJ0_BCL2L11      YYPRRV--FFNNYQP-EDR---PQMVILRLLRCIIRLVWRMH--------
O54918_BCL2L11-05       TYTRRV--FANDYREAEDH---PQMVILQLLRFIFRLVWRRH--------
O88498_BCL2L11-02       TYTRRA--FANDYREAEDH---PQMVILQLLRFIFRLVWRRH--------
A0A2K6GE31_BCL2L11      YYPRRV--FLNNYQADEDH---PQMLILRLLRYIVRLVWRRH--------
A0A2K5CAB2_BCL2L11      YYPRRV--FLNNYQAAEDH---PHMVILRLLRYIVRLVWRMH--------
A0A2K6TRZ5_BCL2L11      YYPRRV--FLNNYQAAEDH---PHMVILRLLRYIVRLVWRMH--------
A0A2K6QIL2_BCL2L11      YYARRV--FLNNYQAAEEH---PQMVILRLLRYIVRLVWRMH--------
A0A2K5NU92_BCL2L11      YYARRV--FLNNYQAAEDH---PQMVILRLLRYIVRLVWRMH--------
A0A2K5HZI7_BCL2L11      YYARRV--FLNNYQAAEDH---PQMVILRLLRYIVRLVWRMH--------
A0A2K5X2I7_BCL2L11      YYARRV--FLNNYQAAEDH---PQMVILRLLRYIVRLVWRMH--------
A0A2K6E226_BCL2L11      YYARRV--FLNNYQAAEDH---PQMVILRLLRYIVRLVWRMH--------
A0A2K5Z8B6_BCL2L11      YYARRV--FLNNYQAAEDH---PQMVILRLLRYIVRLVWRMH--------
A0A2I3M6I1_BCL2L11      YYARRV--FLNNYQAAEDH---PQMVILRLLRYIVRLVWRMH--------
A0A2I3M6I1_BCL2L11      YYARRV--FLNNYQAAEDH---PQMVILRLLRYIVRLVWRMH--------
A0A2K6KJP8_BCL2L11      YYARRV--FLNNYQAAEDH---PQMVILRLLRYIVRLVWRMH--------
A0A2I2YQ13_BCL2L11      YYARRV--FLNNYQAAEDH---PRMVILRLLRYIVRLVWRMH--------
O43521_BCL2L11-02       YYARRV--FLNNYQAAEDH---PRMVILRLLRYIVRLVWRMH--------
A0A2R9CA99_BCL2L11      YYARRV--FLNNYQAAEDH---PRMVILRLLRYIVRLVWRMH--------
A0A2J8JCT2_BCL2L11      YYARRV--FLNNYQAAEDH---PRMVILRLLRYIVRLVWRMH--------
H2P5E2_BCL2L11-01       YYARRV--FLNNYQAAEDH---PRMVILRLLRYIVRLVWRMH--------
A0A337SW42_BCL2L11      YYPRRV--FLNNYQAAEAQ---PQMIILRLLRYIVRLVWRLQ--------
A0A286XJN2_BCL2L11      SYPRRV--FLNHYQPAEDQ---PQMVILRLLRYIIRLVWRMH--------
A0A1S3FHA8_BCL2L11      YYPRRV--FLNNYQAAEDQ---PQMVILRLLRYIIRLVWRMH--------
Q4KMV9_BCL2L11-01       SFSPRRGIFNNLPRPLDN----DQVIILRVLRFIIRLILRL---------
F7FTC8_BCL2L11-01       SYCPRRGLLDNNNPAGNN----HQMGFVHLLRYIIRRVWRLQ--------
A0A2K6E226_BCL2L11      -YYARRVFLNNYQAAEDH----PQMVILRLLRYIVRLVWRMH--------
M3YDI3_BCL2L11-01       -YYPRRVFLNNYPAAEAH----PQMIILRLLRYIIRLVWRLQ--------
F6XMC1_BCL2L11-02       -YYPRRVNWILPFCHRKEVC-LEAFPVLPSKASQSAYWTTIRDRSINTCC
F6XMC1_BCL2L11-01       -YYPRRVNWILPFCHRKEVC-LEAFPVLPSKASQSAYWTTIRDRSINTCC
F7CXT2_BCL2L11-01       SYYPRRGFLDNNYQGAGDH---HQMVILRLLRYIIRLVWRMQ--------
F6XMC1_BCL2L11-08       -TFKSTRTHSLSARNSIHP-------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       -TYTRRVFANDYREAEDH----PQMVILQLLRFIFRLVWRRH--------
O88498_BCL2L11-01       -TYTRRAFANDYREAEDH----PQMVILQLLRFIFRLVWRRH--------
A0A1U8BW10_BCL2L11      -SYRRRV--NNYQEDEDHPH-HPQMVILQLLRFIVRLVWRRH--------
A0A287DFJ0_BCL2L11      -YYPRRVFFNNYQPEDR-----PQMVILRLLRCIIRLVWRMH--------
A0A2K6GE31_BCL2L11      -YYPRRMPLPSD--------------------------------------
A0A2K6GE31_BCL2L11      -YYPRRVFLNNYQADEDH----PQMLILRLLRYIVRLVWRRH--------
A0A2K5CAB2_BCL2L11      -YYPRRLEK-----------------------------------------
F6XMC1_BCL2L11-07       -YYPRRLEK-----------------------------------------
A0A2K6TRZ5_BCL2L11      -YYPRRLEK-----------------------------------------
F6XMC1_BCL2L11-05       -YYPRRISLLPD--------------------------------------
A0A2K6TRZ5_BCL2L11      -YYPRRISLPPD--------------------------------------
A0A2K5CAB2_BCL2L11      -YYPRRISLPSD--------------------------------------
A0A2K5NU92_BCL2L11      -YYARRMSLPPD--------------------------------------
A0A2K5HZI7_BCL2L11      -YYARRMSLPPD--------------------------------------
A0A2K5X2I7_BCL2L11      -YYARRMSLPPD--------------------------------------
F7HHA9_BCL2L11-02       -YYARRMSLPPD--------------------------------------
A0A2K6E226_BCL2L11      -YYARRMSLPPD--------------------------------------
A0A2K5Z8B6_BCL2L11      -YYARRMSLPPD--------------------------------------
A0A2I3M6I1_BCL2L11      -YYARRMSLPPD--------------------------------------
A0A2K6KJP8_BCL2L11      -YYARRMSLPPD--------------------------------------
A0A2K6QIL2_BCL2L11      -YYARRMSLPPD--------------------------------------
A0A2I2YQ13_BCL2L11      -YYARRMPLPPD--------------------------------------
O43521_BCL2L11-16       -YYARRMPLPPD--------------------------------------
O43521_BCL2L11-09       -YYARRMPLPPD--------------------------------------
A0A2R9CA99_BCL2L11      -YYARRMPLPPD--------------------------------------
A0A2J8JCT2_BCL2L11      -YYARRMPLPPD--------------------------------------
A0A2K5NU92_BCL2L11      -YYARRLEK-----------------------------------------
A0A2K5HZI7_BCL2L11      -YYARRLEK-----------------------------------------
A0A2K5X2I7_BCL2L11      -YYARRLEK-----------------------------------------
F7HHA9_BCL2L11-04       -YYARRLEK-----------------------------------------
A0A2K6E226_BCL2L11      -YYARRLEK-----------------------------------------
A0A2K5Z8B6_BCL2L11      -YYARRLEK-----------------------------------------
A0A2I3M6I1_BCL2L11      -YYARRLEK-----------------------------------------
A0A2K6KJP8_BCL2L11      -YYARRLEK-----------------------------------------
A0A2K6QIL2_BCL2L11      -YYARRLEK-----------------------------------------
A0A2I2YQ13_BCL2L11      -YYARRLEK-----------------------------------------
O43521_BCL2L11-18       -YYARRLEK-----------------------------------------
A0A2I3HW02_BCL2L11      -YYARRLEK-----------------------------------------
A0A2R9CA99_BCL2L11      -YYARRLEK-----------------------------------------
A0A2J8JCT2_BCL2L11      -YYARRLEK-----------------------------------------
A0A2K5CAB2_BCL2L11      -YYPRRVFLNNYQAAEDH----PHMVILRLLRYIVRLVWRMH--------
A0A2K5CAB2_BCL2L11      -YYPRRVFLNNYQAAEDH----PHMVILRLLRYIVRLVWRMH--------
F6XMC1_BCL2L11-03       -YYPRRVFLNNYQAAEDH----PHMVILRLLRYIVRLVWRMH--------
A0A2K6TRZ5_BCL2L11      -YYPRRVFLNNYQAAEDH----PHMVILRLLRYIVRLVWRMH--------
A0A2K6TRZ5_BCL2L11      -YYPRRVFLNNYQAAEDH----PHMVILRLLRYIVRLVWRMH--------
A0A2K6QIL2_BCL2L11      -YYARRVFLNNYQAAEEH----PQMVILRLLRYIVRLVWRMH--------
A0A2K6QIL2_BCL2L11      -YYARRVFLNNYQAAEEH----PQMVILRLLRYIVRLVWRMH--------
A0A2K5NU92_BCL2L11      -YYARRVFLNNYQAAEDH----PQMVILRLLRYIVRLVWRMH--------
A0A2K5HZI7_BCL2L11      -YYARRVFLNNYQAAEDH----PQMVILRLLRYIVRLVWRMH--------
A0A2K5X2I7_BCL2L11      -YYARRVFLNNYQAAEDH----PQMVILRLLRYIVRLVWRMH--------
A0A2K6E226_BCL2L11      -YYARRVFLNNYQAAEDH----PQMVILRLLRYIVRLVWRMH--------
A0A2K6E226_BCL2L11      -YYARRVFLNNYQAAEDH----PQMVILRLLRYIVRLVWRMH--------
A0A2K5Z8B6_BCL2L11      -YYARRVFLNNYQAAEDH----PQMVILRLLRYIVRLVWRMH--------
A0A2I3M6I1_BCL2L11      -YYARRVFLNNYQAAEDH----PQMVILRLLRYIVRLVWRMH--------
A0A2K6KJP8_BCL2L11      -YYARRVFLNNYQAAEDH----PQMVILRLLRYIVRLVWRMH--------
A0A2K6KJP8_BCL2L11      -YYARRVFLNNYQAAEDH----PQMVILRLLRYIVRLVWRMH--------
A0A2I2YQ13_BCL2L11      -YYARRVFLNNYQAAEDH----PRMVILRLLRYIVRLVWRMH--------
O43521_BCL2L11-03       -YYARRVFLNNYQAAEDH----PRMVILRLLRYIVRLVWRMH--------
A0A2I3HW02_BCL2L11      -YYARRVFLNNYQAAEDH----PRMVILRLLRYIVRLVWRMH--------
A0A2R9CA99_BCL2L11      -YYARRVFLNNYQAAEDH----PRMVILRLLRYIVRLVWRMH--------
A0A2J8JCT2_BCL2L11      -YYARRVFLNNYQAAEDH----PRMVILRLLRYIVRLVWRMH--------
F1SU81_BCL2L11-02       -YYPRRVMLFSLPPFSPHTL-PPPYI------------------------
A0A337SW42_BCL2L11      -YYPRRLEQ-----------------------------------------
W5PY58_BCL2L11-01       -YYPRRVFV-RHQAIEGH----PQMVLLRVLRYLVRLVWRMQ--------
F7A7D2_BCL2L11-01       -SYPRRVVLNHHQAAEAH----PQMIILRLLRYIIRLVRRLQ--------
A0A286XJN2_BCL2L11      -SYPRRVFLNHYQPAEDQ----PQMVILRLLRYIIRLVWRMH--------
A0A286XJN2_BCL2L11      -SYPRRVFLNHYQPAEDQ----PQMVILRLLRYIIRLVWRMH--------
G1SSY0_BCL2L11-01       -YYPRRVFLNNYPAAEEQ----PQMVILRLLRYIVRLVWRMH--------
H0XW23_BCL2L11-01       -YYPTRVFLHNYQAAEDH----PQMVILRLLRYIVRLVWRLH--------
A0A1S3FHA8_BCL2L11      -YYPRRVFLNNYQAAEDQ----PQMVILRLLRYIIRLVWRMH--------
A0A337SW42_BCL2L11      -YYPRRVFLNNYQAAEAQ----PQMIILRLLRYIVRLVWRLQ--------
G1LDR8_BCL2L11-01       -YYPRRVFLNNYQAAEAH----PQMIILRLLRYIVRLVWRLQ--------
J9NWV6_BCL2L11-01       -YYPRRVFLNNYQAAEAH----PQMIILRLLRYIVRLVWRLQ--------
F1SU81_BCL2L11-01       -YYPRRVFLNNYQAAEAH----PQMVILRLLRYIARLVWRMQ--------
A0A286XF37_PMAIP1-      QQ-----------------------KLMYLISKLISLVT-----------
A0A1U7QLK6_PMAIP1-      RQ-----------------------KLLNFISKLFSLVT-----------
Q9JM54_PMAIP1-01        RQ-----------------------KLLNLISKLFNLVT-----------
Q5U777_PMAIP1-01        RQ-----------------------KLLNFISKLFNLIT-----------
I3LVX0_BIK-01           LRENMWFWRPAAPSTRVPPA-RACRELLPVLLLLGLLLSRALYLRLQ---
A9XRH0_BMF-01           LH------------IQRHQQ-NRNQVWWQLFLFLHNLALNVEANRNRTGQ
R4G9R5_BCL2L11-01       SH--CPRRGFLDYQAVNHQI-IILRLLHYIVRFIWRMQ------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
O61667_EGL1-01          QM-----------MSYSAHA-SDRSLFHRLLDFFAF--------------
A3KND0_BMF-01           SI--------------PHES-HRFHRLFQV--------------------
A0A2K5F6X4_BBC3-02      QY-----ERRRQEEQPQHRP-SPWRVLYNLIMGLLPFPRGHRAPEMEPN-
A0A337SQV0_BBC3-03      LY-----ERRRQEEQQRHRP-SPWRVLYNLIMGLLPLPRARGAPEMEPN-
F1SMU1_PMAIP1-01        RQ-----------------------KLLNLIAKLFRLGT-----------
Q9BXH1_BBC3-04          TM------------------------------------------------
K7E5Y2_BBC3-02          LY----EQR-RREEEQRRHL-SPWRLLYNLISGLLAPQRRNRMPDVEPN-
F7CQN5_BBC3-01          LY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGRAAPEMEPN-
A0A2I3HWI8_BBC3-03      QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
A0A2K6FQZ3_BBC3-04      QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
Q9BXH1_BBC3-05          QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
A0A2R9BZA9_BBC3-01      QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
A0A2I3RGH5_BBC3-03      QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
A0A2K5P2T8_BBC3-03      QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
A0A2K5V8J3_BBC3-03      QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
F7FFP6_BBC3-03          QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
A0A2K6ASP2_BBC3-03      QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
A0A2I3N2Z9_BBC3-03      QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
A0A2K6QZU4_BBC3-04      QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
A0A2R8MW85_BBC3-03      LY----ERR-RQEEQPQHRP-SPWRVLYNLIMGLLPFPRGHRAPEMEPN-
A0A2K6STD6_BBC3-02      QY----ERR-RQEEQPQHRP-SPWRVLYNLIMGLLPFPRGHRAPEMEPN-
G3T2N1_BBC3-01          LY----ERSVRQEEQHRHRP-SPWRVLYNLIMGLLPLPRDHGAPEMEPN-
M3Y0R3_BBC3-01          LY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGRGAPEMEPN-
A0A1U7R5N5_BBC3-01      QY----ERR-RQEEQHRHRP-SPWRVMYNLFMGLLPLPRDPGAPEMEPN-
Q99ML1_BBC3-02          QY----ERR-RQEEQHRHRP-SPWRVMYNLFMGLLPLPRDPGAPEMEPN-
Q80ZG6_BBC3-01          QY----ERR-RQEEQHRHRP-SPWRVMYNLFMGLLPLPRDPGAPEMEPN-
H0XQ00_BBC3-01          QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
J9NTK9_BBC3-01          LY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGRGAPEMEPN-
A0A337SQV0_BBC3-02      LY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRARGAPEMEPN-
F1RM01_BBC3-01          LY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGRGAPEMEPN-
A0A2K6FQZ3_BBC3-01      QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
Q9BXH1_BBC3-06          QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
A0A2I3RIG5_BBC3-02      QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
H2NZD3_BBC3-01          QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
A0A2K6QZU4_BBC3-01      QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
A0A0D9S2H2_BBC3-01      QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
B4DQK3_BBC3-01          QY----ERR-RQEEQQRHRP-SPWRVLYNLIMGLLPLPRGHRAPEMEPN-
F6TGJ4_BMF-01           FH---------LQ---RLQQ-NRNQFWSQILIFFRNLVMHPVGNRAGLAQ
G1PAU1_BMF-01           LQ---------MQ---QHQQ-NRNRMWWQFLLFLHNLALNGDENRNGAGP
A0A1U8CPE0_BMF-02       LH---------IQ---QHQQ-NRDRAWWQVFLFLQNLALNREENREGVGP
A0A286XXB0_BMF-03       LH---------IQ---QHQQ-NRNRAWWQVLLFMHNLGLNGEENREGAGP
I3MDS9_BMF-02           LH---------MQ---QHQQ-NRNRVWWQILLFLHNLALNGDENRDRAGP
A0A287AIU8_BMF-05       LH---------MQ---QEFP-S----WLG---------------------
A0A287AIU8_BMF-03       LH---------MQ---QHQQ-NQNRVWWQILLFLHNLALHGDENRNGAGP
A0A287AIU8_BMF-01       LH---------MQ---QHQQ-NQNRVWWQILLFLHNLALHGDENRNGAGP
A0A287AIU8_BMF-02       LH---------MQ---QHQQ-NQNRVWWQILLFLHNLALHGDENRNGAGP
A0A287AIU8_BMF-04       LH---------MQ---QHQQ-NQNRVWWQILLFLHNLALHGDENRNGAGP
A0A1S3EQA2_BMF-02       LH---------TQ---RHQQ-HRDRAWGQVLLFLHNLALNR-ENRDRAGP
A2AV74_BMF-02           LH---------TQ---QHQQ-NRDRAWWQVFLFLQNLALNRQENREGVGP
A0A337SQV0_BBC3-01      QR---------AV---RAAE-TRGAAATPPLTLEGPVQSHHGTPALTQGP
Q9BXH1_BBC3-03          QR---------TV---RAAE-TRGAAAAPPLTLEGPVQSHHGTPALTQGP
A0A2K5KGR6_BMF-01       GH---------QE---HRQE-GHRAGLTLCLVKLFFCCYFAF--------
A0A2K6FFR1_BMF-02       --------------------------------------------------
M3WRS0_BMF-02           --------------------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
F7HPK0_BMF-02           --------------------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
G3QIN5_BMF-02           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
G7PAW6_BMF-01           --------------------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A1S3EQA2_BMF-01       LH---------TQ---RHQQ-HRDRAWGQVLLFLHNLALN-RENRDRAGP
Q8K589_BMF-01           LH---------MQ---QHQQ-NRDRAWRQVFLFLQNLALNRRENREGVGP
A2AV74_BMF-01           LH---------TQ---QHQQ-NRDRAWWQVFLFLQNLALNRQENREGVGP
I3MDS9_BMF-01           LH---------MQ---QHQQ-NRNRVWWQILLFLHNLALNGDENRDRAGP
G3T7Z4_BMF-01           LH---------MQ---RHQQ-NRNPAWRQILQFLHHLAVNGEENRNGAGP
F6X3N6_BMF-01           LH---------MQ---RHQQ-NRNHVWWQILLFLHNLALNREENRNGAGP
G3WDQ2_BMF-01           LH---------MQ---RHQQ-NQNHVWWQILLFLHNLALNREENRNGAGP
A0A1S3WU31_BMF-01       LH---------MQ---QHQQ-NRNPVWWPFLLFLHNLALNEGENRNREAP
Q96LC9_BMF-06           -----------------HQQ-NQNRVWWQILLFLHNLALNGEENRNGAGP
A0A286XXB0_BMF-02       LH---------IQ---QHQQ-NRNRAWWQVLLFMHNLGLNGEENREGAGP
J9PB65_BMF-01           LH---------MQ---QHQQ-NQNRVWWQILLFLHNLALNADENRNGAGP
A0A1U8CPE0_BMF-01       LH---------IQ---QHQQ-NRDRAWWQVFLFLQNLALNREENREGVGP
A0A286XXB0_BMF-01       LH---------IQ---QHQQ-NRNRAWWQVLLFMHNLGLNGEENREGAGP
G1SR62_BMF-01           LH---------LQ---QHQQ-NRNRVWWQILLFLHNLALNGDENRDGAGP
F6TJI0_BMF-01           LH---------MQ---QHQQ-NRNRVWWQTLLFLHNLALNGDENRNGAGP
Q05KI3_BMF-01           LH---------MQ---QYQQ-NRNRMWWQILLFLHNVALNGDENRNGAGP
W5QFV1_BMF-01           LH---------MQ---QHQQ-NRNRMWWQILLFLHNVALNGDENRNGAGP
M3WRS0_BMF-01           LH---------MQ---QHQQ-NRRRVWWQILLFLHNLALNAEENRNGAGP
M3YAD5_BMF-01           LH---------MQ---QHQQ-NQNRVWWQILLFLHNLALNADENRNGAGP
A0A2K6FFR1_BMF-01       LH---------VQ---QHQQ-NQNRMWWQILLFLHNLALNGEENRNGAGP
H0WYH6_BMF-01           LH---------VQ---QHQQ-NQNRVWWQVLFFLHNLALNGEENRNGAGP
A0A096NTE9_BMF-01       LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGVDP
A0A2K6L933_BMF-02       LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGAGP
A0A096NTE9_BMF-02       LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGVDP
A0A2K5MJY6_BMF-02       LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGAGP
A0A2K5KGR6_BMF-02       LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGAGP
G7PAW6_BMF-02           LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGAGP
F7CM09_BMF-02           LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEQNRNGAGP
A0A2K6B5G4_BMF-02       LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGAGP
A0A2K6B5G4_BMF-01       LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGAGP
A0A2K6B5G4_BMF-04       LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGAGP
A0A2K5Z4C3_BMF-01       LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGAGP
A0A2K6L933_BMF-03       LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGAGP
A0A2K6L933_BMF-01       LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGAGP
A0A2K6RAW8_BMF-01       LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGAGP
A0A0D9R4R5_BMF-01       LH---------VQ---QHQQ-NRNRMWWQILLFLHNLALNGEENRNGAGP
F7HPK0_BMF-01           LH---------VQ---QHQQ-NRNRMWWQVLLFLHNLALNGEENRNGAGP
A0A2K5E1W9_BMF-01       LH---------VQ---QHQQ-NRNRVWWQVLLFLHNLALNGEENRNGAGP
A0A2K6TW86_BMF-02       LH---------VQ---QHQQ-NRNRVWWQVLLFLHNLALNGEENRNGAGP
A0A2K6TW86_BMF-01       LH---------VQ---QHQQ-NRNRVWWQVLLFLHNLALNGEENRNGAGP
G3QIN5_BMF-01           LH---------VQ---QHQQ-NQNRVWWQILLFLHNLALNGEENRNGAGP
Q96LC9_BMF-01           LH---------VQ---QHQQ-NQNRVWWQILLFLHNLALNGEENRNGAGP
Q96LC9_BMF-02           LH---------VQ---QHQQ-NQNRVWWQILLFLHNLALNGEENRNGAGP
Q96LC9_BMF-03           LH---------VQ---QHQQ-NQNRVWWQILLFLHNLALNGEENRNGAGP
Q96LC9_BMF-04           LH---------VQ---QHQQ-NQNRVWWQILLFLHNLALNGEENRNGAGP
A0A2R9BS98_BMF-01       LH---------VQ---QHQQ-NQNRVWWQILLFLHNLALNGEENRNGAGP
A0A2J8QDD5_BMF-02       LH---------VQ---QHQQ-NQNRVWWQILLFLHNLALNGEENRNGAGP
A0A2J8T301_BMF-01       LH---------VQ---QHQQ-NRNRVWWQILLFLHNLALNGEENRNGAGP
H9GL49_BMF-01           LH---------LQ---RHQQ-NRNQVWWQIFFFLHNVALNMEANRHRAGR
A9XRG9_BMF-01           --------------------------------------------------
K7FRX2_BMF-01           LH---------IQ---RHQQ-NRNQVWWQILLFLHNLALNVEANRNHIGQ
U3JS06_BMF-01           LH---------IQ---RHQQ-NRNQVWWQLFLFLHNLALNTEVNRNHTGQ
H0ZMX5_BMF-01           LH---------IQ---RHQQ-NRNQVWWQLFLFLHNLALNTEVNRNHTGQ
A9XRG9_BMF-02           LH---------IQ---RHQQ-NRNQVWWQLFLFLHNLALNVEANRNRTGQ
A9XRG9_BMF-03           LH---------IQ---RHQQ-NRNQVWWQLFLFLHNLALNVEANRNRTGQ
G1NHG8_BMF-01           LH---------IQ---RHQQ-NRNQVWWQLFLFLHNLALNVEANRNRTGQ
W5N4P7_BMF-01           DY---------LHMYRRNQR-NHQPMWWRLALALFTFLFERQGNRNQLRG
I3K2D6_BMF-01           ER---------LQLYHRNQR-NQGPMWWRLAAALLSLLFDRGFIAGGGGG
A0A096LRV0_BMF-01       EH---------LQQYQQNQR-NQGPLWWRMTAALLSLLFHRGFIAGGGGA
A0A2U9CJH3_BMF-01       EH---------LQLYHRNQR-NQGPLWWRLAAALLSLLFDRGFLAGGGGA
Q0GKC7_BMF-01           EH------------IMHHQR-PQDPLWRRVATAVLTLLFGARENRR----
A0A2K5JY52_PMAIP1-      MR-----------GLQKRIF-LRRCTFHQFEARLHCN-------------
A0A096MPU8_PMAIP1-      IG-----------GLQKRLF-LRRCTLHQFEERLHCNW------------
A0A2K5ZWH1_PMAIP1-      IR-----------GLQKRLF-LRRCILHKFEERLHCNW------------
A0A2K5VPX2_PMAIP1-      IR-----------GLQKRLF-LRRCTLHQFEERLHCNW------------
A0A2K6BV75_PMAIP1-      IR-----------GLQKRLF-LRRCTLHQFEERLHCNW------------
A0A2K6KJF2_PMAIP1-      IR-----------GLQTRIF-LRRCTFHQFEERLHCNW------------
A0A2K6NC45_PMAIP1-      IR-----------GLQTRIF-LRRCTFHQFEERLHCNW------------
Q13794_PMAIP1-02        MR-----------GLLQKSF-LRRCTFHQFEERLHCN-------------
A0A2R9AKC9_PMAIP1-      MR-----------GLLQKSF-LRRCTFHQFEERLHCNW------------
A0A1D5QGJ8_PMAIP1-      IR-----------GLQKRLF-LRRCTLHQFEERLHCN-------------
A0A2I2YVQ5_PMAIP1-      MR-----------GLLQKSF-LRRCTFHQFEERLHCNWEECEGAFMGALG
A0A2I3SX38_PMAIP1-      MR-----------GLLQKSF-LRRCTFHQFEERLHCNW------------
C1C3S9_BAD-01           RRKNK-DRS-QSENDKH---------------------------------
F6Z067_BAD-01           SRRKS-KGR-DESGDEE---------------------------------
M3XHJ5_BCL2L11-01       LAQRE-QHP-ETHGKNPLNF-T----------------------------
W5QCU2_BIK-01           LS-----------WGCRF--------------------------------
O70337_BIK-04           LG-----------GAWYLQL-Q----------------------------
O70337_BIK-02           LG-----------GAWYLQL-Q----------------------------
O70337_BIK-01           LG-----------GAWYLQL-Q----------------------------
Q925D2_BIK-01           LG-----------GAWHLQL-Q----------------------------
G1TZR9_BIK-01           GA-----------GSWGLRM-P----------------------------
F1PUF4_BIK-01           LG-----------WGLRLLQ------------------------------
H0XAE7_BIK-01           LA-----------GGLHLLL-K----------------------------
A0A2K6FM79_BIK-01       LG-----------GGLHLLL-K----------------------------
A0A1S3FUQ7_BIK-01       LC-----------GALQLLL-Q----------------------------
H0W025_BIK-01           L------------GTLRLLL-Q----------------------------
A0A2K5CLG5_BIK-01       FS-----------GGLHLLL-K----------------------------
F7FUT7_BIK-01           FS-----------GGLHLLL-K----------------------------
A0A2K6TBD7_BIK-01       FS-----------GGLRLLL-K----------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           LS-----------GGLYLLN------------------------------
G3QCT2_BIK-01           LS-----------GGLHLLL-K----------------------------
A0A2R8ZXD2_BIK-01       LS-----------GGLHLLL-K----------------------------
H2QLU7_BIK-01           LS-----------GGLHLLL-K----------------------------
Q13323_BIK-01           LS-----------GGLHLLL-K----------------------------
A0A2K6MCW0_BIK-01       LS-----------GGLHLLL-K----------------------------
A0A2K6QK74_BIK-01       LS-----------GGLHLLL-K----------------------------
A0A0D9QZY8_BIK-01       LS-----------GGLHLLL-K----------------------------
A0A2K5VW94_BIK-01       LS-----------GGLHLLL-K----------------------------
A0A2K6DBJ4_BIK-01       LS-----------GGLHLLL-K----------------------------
A0A2K5J4Q7_BIK-01       LS-----------GGLHLLL-K----------------------------
A0A096NKG5_BIK-01       LS-----------GGLHLLL-K----------------------------
A0A2K5LDM6_BIK-01       LS-----------GGLHLLL-K----------------------------
A0A2K5XSA1_BIK-01       LS-----------GGLHLLL-K----------------------------
I3K7B6_BAD-01           LLDKGEMK--------LKKL-HHSKTWWSYLFSHQETEGENNHLE-----
B5X1T1_BAD-01           WLDKGEPKR-GISPGGVKQ--EVSRGWFSFLWSPKKAEGRE---------
Q4V925_BAD-02           --DKG-MKR-VKSAGTARQM-SQSPSWLAFLWSHKESDAESRPAE-----
Q4V925_BAD-03           --DKG-MKR-VKSAGTARQM-SQSPSWLAFLWSHKESDAESRPAE-----
A7MCM4_BAD-01           --DKGQMKR-VKSAGTARQM-SQSPSWLAFLWSHKESDAESRPAE-----
Q4V925_BAD-04           --DKGQMKR-VKSAGTARQM-SQSPSWLAFLWSHKESDAESRPAE-----
Q4V925_BAD-01           --DKGQMKR-VKSAGTARQM-SQSPSWLAFLWSHKESDAESRPAE-----
G3Q8B3_BAD-01           LLDKGEMRR-VKSAGTTKQM-QHSKSWWSSLFSHQEMEGENNHHE-----
A0A087X8P8_BAD-01       LLDKGEMRK-VSSTGSNRPI-HHSRSWWSYLFSHQETEGENNHHENHASR
E7FBJ6_BAD-01           WLDKG-VSK-----TPNSQK-QTYRGWFSFL---WSPKEEEGRE------
B5XEF1_BAD-01           WLDKG-VPK-RGIIPRGGKQ-KVSRGWFSFL---WSPKEAEGRE------
G1SS60_BAD-01           SVKKG-LPR-PKSAGTAMQM-RESSSWTRVIQSWWDRNLGKGGSAPSQ--
Q9GL49_PMAIP1-01        RVALPPDPE-VECAIQFRRI-GDKLNFRQKLLNLIAKLFRLGT-------
H3D8J8_BAD-01           LLDKGGMRK-TSSAGSARQM-HHSRSWWSYLFSHQETESENNHHD-----
H3ANP3_BAD-03           SF-LG-LPR-PKSAGAAGEM-VDESWWKKLIRSLKGRGQPRDPPGQ----
H3ANP3_BAD-04           SF-LG-LPR-PKSAGAAGEM-VDESWWKKLIRSLKGRGQPRDPPGQ----
H3ANP3_BAD-01           SF-LG-LPR-PKSAGAAGEM-VDESWWKKLIRSLKGRGQPRDPPGQQGVS
H3ANP3_BAD-02           SF-LG-LPR-PKSAGAAGEM-VDESWWKKLIRSLKGRGQPRDPPGQQGVS
A0A337SAW2_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSPSWTRFIQSWWDRNLGRGGSAPSQ--
A0A2U9BAC9_BAD-01       LLDKGEMRK-VKSAGTARQM-HHSQSWWSYLFSHQEMEGENNHHENHTQR
A0A2I3TBK7_BAD-01       HP-ET-PPV-PTALGSHLEY-GRKYFPQAYAK--------RGSVLSPLEG
A0A2R8Z697_BAD-02       HP-ET-PPV-PTALGSHLEY-GRKYFPQAYAK--------RGSVLSPLEG
A0A2I2Z8C7_BAD-03       HP-ET-PPV-PTALGSHLEY-GRKYFPQAYAK--------RGSVLSPLEG
Q92934_BAD-03           HP-ET-PPV-PTALGSHLEY-GRKYFPQAYAK--------RGSVLSPLEG
A0A2K5M0C1_BAD-02       RP-ET-PPA-LTVLVGHLGY-GRKCFPQALCK--------RGSVLPLSVG
A0A2K5XJR2_BAD-02       RP-ET-PPA-LTVLVGHLGY-GRKCFPQASCK--------RGSVLPLSVG
A0A2I3MCN5_BAD-03       RP-ET-PPA-LTVLVGHLGY-GRKCFPQALCK--------RGSVLPLSVG
A0A2K5VCD8_BAD-02       RP-ET-PPA-LTVLVGHLGY-GRKCFPQALCK--------RGSVLPLSVG
F7GVS7_BAD-02           RP-ET-PPA-LTVLVGHLGY-GRKCFPQALCK--------RGSVLPLSVG
A0A2K6E7J3_BAD-02       RP-ET-PPA-LTVLVGHLGY-GRKCFPQALCK--------RGSVLPLSVG
A0A2K5E6K7_BAD-02       HP-ET-PPV-PIALGGHLGY-GRKCFLQ---------------------G
A0A2K6TG62_BAD-02       HP-ET-LPA-PIALGGHLGH-GRKCFLQ---------------------G
A0A2K5E6K7_BAD-03       -V-AT-APT-PQGRRRTKGW-RRSPAPFGAVRAQHPPTSGQHSAMAASSG
A0A2K5HKW9_BAD-02       GV-AT-APT-PRGRRRTKGW-RRSPAPFGAARAPRPLTSGQHSDMAASSG
A0A2K6N1A1_BAD-02       GV-AT-APT-PRGRRRTKGW-RRSPAPFGAARAPRPLTSGQHSDMAASSG
A0A2K6PUM5_BAD-02       GV-AT-APT-PRGRRRTKGW-RRSPAPFGAARAPRPLTSGQHSDMAASSG
A0A2K5M0C1_BAD-03       GV-AT-APT-PRGRRRTKGW-RRSPAPFGAARAPRPPTSGQHSVMAASSG
A0A2K5VCD8_BAD-03       GV-AT-APT-PRGRRRTKGW-RRSPAPFGAARAPRPPTSGQHSVMAASSG
F7GVS7_BAD-03           GV-AT-APT-PRGRRRTKGW-RRSPAPFGAARAPRPPTSGQHSVMAASSG
A0A2K5XJR2_BAD-03       GV-AT-APT-PRGRRRTKGW-RRSPAPFGAARAPRPPTSGQHSVMAASSG
A0A2I3MCN5_BAD-02       GV-AT-APT-PRGRRRTKGW-RRSPAPFGAARAPRPPTSGQHSVMAASSG
A0A2K6E7J3_BAD-03       AV-AT-APT-PRGRRRTKGW-RRSPAPFGAARAPRPPTSGQHSVMAASSG
A0A2I2Z8C7_BAD-04       GV-AT-APT-PRGRRTTKGW-GRSPAPFGAARARRPPTSGQHSAMAASSG
Q92934_BAD-04           GV-AT-APT-PRGRRTTKGW-GRSPAPFGAARARRPPTSGQHSAMAASSG
A0A2I3TBK7_BAD-03       GV-AT-APT-PRGRRTTKGW-GRSPAPFGAARARRPPTSGQHSAMAASSG
A0A2R8Z697_BAD-03       GV-AT-APT-PRGRRTTKGW-GRSPAPFGAARARRPPTSGQHSAMAASSG
F6SJL0_BAD-02           GV-AT-ART-PQGRRRTKGW-RRSPAPFGAVRARHPPTSGQHSAMAASSG
A0A2K6TG62_BAD-03       GV-AT-ART-PQGRRGTKGW-RRSPALFGAVRARHPPTSGQHSDMAASSG
G1P8C5_BAD-01           SFKKG-LPR-PKSAGTATQM-WQKSSWTRFFQSWWDRNSGRGGSAPSQ--
W5P8G9_BAD-01           SF-KG-LPR-PKSAGTATQM-RQSPSWTRFLQSWLSRNLGRGGSAPSQ--
G3VRY4_BAD-01           TF-KG-LPR-PKSAGTASQM-RRSHGWTRTFQSWFGRNLGKGSVGPSH--
G3VRY4_BAD-02           TF-KG-LPR-PKSAGTASQM-RRSHGWTRTFQSWFGRNLGKGSVGPSH--
G3TP47_BAD-01           YF-KG-LPR-PKSAGTATQM-RQSPSWTRIIQAWWDRNLGRGSSAPSQ--
I3MBM5_BAD-01           SF-KG-LPR-PRSAGTASQM-RQSSSWTRFIQSWWDRNLGRRGSAPSQ--
I3MBM5_BAD-02           SF-K-----------------------VTFSQSPFLRA------------
A0A091DDU4_BAD-01       SF-KG-LPR-PKSAGTATKL-WQSSSWTRAIQSWWDRNLGRGGSAPSQ--
Q61337_BAD-02           SF-KG------------EEL-TYSLSPFRCVQ------------------
Q61337_BAD-03           SF-KG-LPR-PKSAGTATQM-RQSAGWTRIIQSWWDRNLGKGGSTPSQ--
A0A1U7Q4V0_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSASWTRIIQSWWDRNLGKGGSTPSQ--
Q61337_BAD-01           SF-KG-LPR-PKSAGTATQM-RQSAGWTRIIQSWWDRNLGKGGSTPSQ--
G1MI17_BAD-01           SF-KG-LPR-PKSAGTATQM-RQSPSWTRVIQSWWDRNLGRGGSAPSQ--
A0A287AEF3_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSPSWKRFLQSWWYRNSGRGGPAPSQ--
O35147_BAD-01           SF-KG-LPR-PKSAGTATQM-RQSASWTRIIQSWWDRNLGKGGSTPSQ--
M3YNE7_BAD-01           SF-KG-LPR-PKSAGTATQM-RQSPSWTRVIQSWWDRNLGRGGSAPSQ--
F1MUT9_BAD-01           SF-KG-LPR-PKSAGTATQM-RQSPSWTRFLQSWLSRNLGRGGSAPSQ--
Q3SYZ0_BAD-01           SF-KG-LPR-PKSAGTATEM-RQSPSWTRFLQSWLSRNLGRGGSAPSQ--
F7DN67_BAD-01           SFQKA-LPR-PKSAGTATQM-RQSPSWTRAIQSWWDRNLGRGGSAPSQ--
H0WVR2_BAD-01           SFKKG-LPR-PKSAGTATQM-RQSSSWTRVIQSWWDRNVGRGGSAPCQ--
H0V608_BAD-01           SF-KG-LPR-PKSAGTATKL-WQNSNWTRAIQSWWDRNLGRGGSAPSQES
A0A1S3FL84_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSSSWTRIFQSWWDRNLGRG-SAPSQ--
A0A2K5E6K7_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSSSWTQVIQSWWDRNLGRGGSAPSQ--
A0A2K6TG62_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSSSWTRVIQSWWDRNLGRGGSAPSQ--
A0A0D9R491_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2K5M0C1_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2K5VCD8_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
F7GVS7_BAD-01           SF-KG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2K6E7J3_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2K5XJR2_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2I3MCN5_BAD-04       SF-KG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2K6N1A1_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2K6PUM5_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2K5HKW9_BAD-01       SF-KG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
B4DZQ9_BAD-01           SFKKG-LPR-PKSAGTATQM-RQSPRRLR---------------------
A0A2K6GWV0_BAD-01       SFKKG-LPR-PKSAGTATQI-RQSSSWTRVIQSWWDRNVGRGGSAPSQ--
F6SJL0_BAD-01           SFKKG-LPR-PKSAGTATQM-RQSSSWTRVIQSWWDRNLGRGGSAPSQ--
A0A2I3MCN5_BAD-01       SFKKG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2I2Z8C7_BAD-01       SFKKG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2I2Z8C7_BAD-02       SFKKG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
Q92934_BAD-01           SFKKG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
Q92934_BAD-02           SFKKG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2I3TBK7_BAD-02       SFKKG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2R8Z697_BAD-01       SFKKG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2J8TYJ3_BAD-01       SFKKG-LPR-PKSAGTATQM-RQSSSWTRVFQSWWDRNLGRGSSAPSQ--
F1PK10_BAD-01           SF-KG-LPR-PKSAGTATQM-RQSPSWTRVIQSWWDRNLGRGGSAPSQ--
Q45KI9_BAD-01           SF-KG-LPR-PKSAGTATQM-RQSPSWTRVIQSWWDRNLGRGGSAPSQ--
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A287AZR7_PMAIP1-      --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
K7E5Y2_BBC3-01          --------------------------------------------------
F6RS78_BIK-01           --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
G3MWR6_HRK-01           --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A1D5R1E4_HRK-01       --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
E2RLD4_HRK-01           --------------------------------------------------
F7GVS7_BAD-04           --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A1S3FHA8_BCL2L11      --------------------------------------------------
Q4KMV9_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F6XMC1_BCL2L11-02       AKAQRIISGNILQSVARWCQMMLTPQLYLVLKDGGPVVKSALKLPWFHSP
F6XMC1_BCL2L11-01       AKAQRIISGNILQSVARWCQMMLTPQLYLVLKDGGPVVKSALKLPWFHSP
F7CXT2_BCL2L11-01       --------------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-03       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
F7A7D2_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FHA8_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-01       --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A9XRH0_BMF-01           R-------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
F7CQN5_BBC3-01          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
F6TGJ4_BMF-01           R-------------------------------------------------
G1PAU1_BMF-01           R-------------------------------------------------
A0A1U8CPE0_BMF-02       W-------------------------------------------------
A0A286XXB0_BMF-03       R-------------------------------------------------
I3MDS9_BMF-02           R-------------------------------------------------
A0A287AIU8_BMF-05       --------------------------------------------------
A0A287AIU8_BMF-03       R-------------------------------------------------
A0A287AIU8_BMF-01       R-------------------------------------------------
A0A287AIU8_BMF-02       R-------------------------------------------------
A0A287AIU8_BMF-04       R-------------------------------------------------
A0A1S3EQA2_BMF-02       R-------------------------------------------------
A2AV74_BMF-02           W-------------------------------------------------
A0A337SQV0_BBC3-01      RGPGDGAQLGACTRPVDVGDLGGRTLPPPDALASAGDFFCTM--------
Q9BXH1_BBC3-03          QSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM--------
A0A2K5KGR6_BMF-01       --------------------------------------------------
A0A2K6FFR1_BMF-02       --------------------------------------------------
M3WRS0_BMF-02           --------------------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
F7HPK0_BMF-02           --------------------------------------------------
A0A2K6TW86_BMF-03       --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
G3QIN5_BMF-02           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
G7PAW6_BMF-01           --------------------------------------------------
A0A2K6B5G4_BMF-03       --------------------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A1S3EQA2_BMF-01       R-------------------------------------------------
Q8K589_BMF-01           W-------------------------------------------------
A2AV74_BMF-01           W-------------------------------------------------
I3MDS9_BMF-01           R-------------------------------------------------
G3T7Z4_BMF-01           R-------------------------------------------------
F6X3N6_BMF-01           R-------------------------------------------------
G3WDQ2_BMF-01           R-------------------------------------------------
A0A1S3WU31_BMF-01       R-------------------------------------------------
Q96LC9_BMF-06           R-------------------------------------------------
A0A286XXB0_BMF-02       R-------------------------------------------------
J9PB65_BMF-01           SFQLVPGISCSGAQQDCSCL------------------------------
A0A1U8CPE0_BMF-01       W-------------------------------------------------
A0A286XXB0_BMF-01       R-------------------------------------------------
G1SR62_BMF-01           R-------------------------------------------------
F6TJI0_BMF-01           R-------------------------------------------------
Q05KI3_BMF-01           R-------------------------------------------------
W5QFV1_BMF-01           R-------------------------------------------------
M3WRS0_BMF-01           R-------------------------------------------------
M3YAD5_BMF-01           R-------------------------------------------------
A0A2K6FFR1_BMF-01       R-------------------------------------------------
H0WYH6_BMF-01           R-------------------------------------------------
A0A096NTE9_BMF-01       RYKNARRSVRKLKASSFLSCQPE---------------------------
A0A2K6L933_BMF-02       RPLTWNGGRCQTLLKGRLMCL-----------------------------
A0A096NTE9_BMF-02       RPLTWNGAVVKPC-------------------------------------
A0A2K5MJY6_BMF-02       R-------------------------------------------------
A0A2K5KGR6_BMF-02       R-------------------------------------------------
G7PAW6_BMF-02           R-------------------------------------------------
F7CM09_BMF-02           R-------------------------------------------------
A0A2K6B5G4_BMF-02       R-------------------------------------------------
A0A2K6B5G4_BMF-01       R-------------------------------------------------
A0A2K6B5G4_BMF-04       R-------------------------------------------------
A0A2K5Z4C3_BMF-01       R-------------------------------------------------
A0A2K6L933_BMF-03       R-------------------------------------------------
A0A2K6L933_BMF-01       R-------------------------------------------------
A0A2K6RAW8_BMF-01       R-------------------------------------------------
A0A0D9R4R5_BMF-01       R-------------------------------------------------
F7HPK0_BMF-01           R-------------------------------------------------
A0A2K5E1W9_BMF-01       R-------------------------------------------------
A0A2K6TW86_BMF-02       R-------------------------------------------------
A0A2K6TW86_BMF-01       R-------------------------------------------------
G3QIN5_BMF-01           R-------------------------------------------------
Q96LC9_BMF-01           R-------------------------------------------------
Q96LC9_BMF-02           R-------------------------------------------------
Q96LC9_BMF-03           R-------------------------------------------------
Q96LC9_BMF-04           R-------------------------------------------------
A0A2R9BS98_BMF-01       R-------------------------------------------------
A0A2J8QDD5_BMF-02       R-------------------------------------------------
A0A2J8T301_BMF-01       R-------------------------------------------------
H9GL49_BMF-01           SCTTTYFPFTEPPVCFPFSEMLPRFCLEAI--------------------
A9XRG9_BMF-01           --------------------------------------------------
K7FRX2_BMF-01           R-------------------------------------------------
U3JS06_BMF-01           R-------------------------------------------------
H0ZMX5_BMF-01           R-------------------------------------------------
A9XRG9_BMF-02           R-------------------------------------------------
A9XRG9_BMF-03           R-------------------------------------------------
G1NHG8_BMF-01           R-------------------------------------------------
W5N4P7_BMF-01           DQR-----------------------------------------------
I3K2D6_BMF-01           GRR-----------------------------------------------
A0A096LRV0_BMF-01       GRR-----------------------------------------------
A0A2U9CJH3_BMF-01       GRRQAHTKRRAKASGPQNRASSVERTVQAMTNQFTSLPPQQLPPPANGRL
Q0GKC7_BMF-01           --------------------------------------------------
A0A2K5JY52_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A1D5QGJ8_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      NGRWNTSK------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
F6Z067_BAD-01           --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
F1PUF4_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
A0A1S3FUQ7_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A087X8P8_BAD-01       TE------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
G1SS60_BAD-01           --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
H3ANP3_BAD-01           IRGPD---------------------------------------------
H3ANP3_BAD-02           IRGPD---------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       NE------------------------------------------------
A0A2I3TBK7_BAD-01       GLTPIPFRCV----------------------------------------
A0A2R8Z697_BAD-02       GLTQIPFRCV----------------------------------------
A0A2I2Z8C7_BAD-03       RLTQIPFRCV----------------------------------------
Q92934_BAD-03           GLTQIPFRCV----------------------------------------
A0A2K5M0C1_BAD-02       GLTQIPFRCM----------------------------------------
A0A2K5XJR2_BAD-02       GLTQIPFRCM----------------------------------------
A0A2I3MCN5_BAD-03       GLTQIPFRCM----------------------------------------
A0A2K5VCD8_BAD-02       GLTQIPFRCM----------------------------------------
F7GVS7_BAD-02           GLTQIPFRCM----------------------------------------
A0A2K6E7J3_BAD-02       GLTQIPFRCM----------------------------------------
A0A2K5E6K7_BAD-02       ELTQIPFRCV----------------------------------------
A0A2K6TG62_BAD-02       GLTQIPFRCV----------------------------------------
A0A2K5E6K7_BAD-03       G-------------------------------------------------
A0A2K5HKW9_BAD-02       G-------------------------------------------------
A0A2K6N1A1_BAD-02       G-------------------------------------------------
A0A2K6PUM5_BAD-02       G-------------------------------------------------
A0A2K5M0C1_BAD-03       G-------------------------------------------------
A0A2K5VCD8_BAD-03       G-------------------------------------------------
F7GVS7_BAD-03           G-------------------------------------------------
A0A2K5XJR2_BAD-03       G-------------------------------------------------
A0A2I3MCN5_BAD-02       G-------------------------------------------------
A0A2K6E7J3_BAD-03       G-------------------------------------------------
A0A2I2Z8C7_BAD-04       G-------------------------------------------------
Q92934_BAD-04           G-------------------------------------------------
A0A2I3TBK7_BAD-03       G-------------------------------------------------
A0A2R8Z697_BAD-03       G-------------------------------------------------
F6SJL0_BAD-02           G-------------------------------------------------
A0A2K6TG62_BAD-03       G-------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3VRY4_BAD-01           --------------------------------------------------
G3VRY4_BAD-02           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
I3MBM5_BAD-01           --------------------------------------------------
I3MBM5_BAD-02           --------------------------------------------------
A0A091DDU4_BAD-01       --------------------------------------------------
Q61337_BAD-02           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
A0A1U7Q4V0_BAD-01       --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
O35147_BAD-01           --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
H0V608_BAD-01           V-------------------------------------------------
A0A1S3FL84_BAD-01       --------------------------------------------------
A0A2K5E6K7_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5M0C1_BAD-01       --------------------------------------------------
A0A2K5VCD8_BAD-01       --------------------------------------------------
F7GVS7_BAD-01           --------------------------------------------------
A0A2K6E7J3_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2I3MCN5_BAD-04       --------------------------------------------------
A0A2K6N1A1_BAD-01       --------------------------------------------------
A0A2K6PUM5_BAD-01       --------------------------------------------------
A0A2K5HKW9_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F6SJL0_BAD-01           --------------------------------------------------
A0A2I3MCN5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z697_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
                                                                          

U3IW89_BCL2L11-01       ------
Q6JTU4_BCL2L11-01       ------
A0A0P0HZF9_PMAIP1-      ------
Q0GKC8_PMAIP1-01        ------
A0A2I3HX97_PMAIP1-      ------
A0A1D5PAR2_PMAIP1-      ------
A0A2K6EM90_PMAIP1-      ------
G1P8F9_PMAIP1-01        ------
G3T0P7_PMAIP1-01        ------
Q1PCT2_PMAIP1-01        ------
G1LIZ7_PMAIP1-01        ------
A0A2K5NJZ2_PMAIP1-      ------
A0A0D9S003_PMAIP1-      ------
A0A2K5VPX2_PMAIP1-      ------
A0A2K6BV75_PMAIP1-      ------
A0A2K5ZWH1_PMAIP1-      ------
A0A096MPU8_PMAIP1-      ------
A0A2K5JY52_PMAIP1-      ------
A0A2K6KJF2_PMAIP1-      ------
A0A2K6NC45_PMAIP1-      ------
A0A2K6S6C4_PMAIP1-      ------
A0A2I2YVQ5_PMAIP1-      ------
Q13794_PMAIP1-01        ------
A0A2R9AKC9_PMAIP1-      ------
A0A2I3SX38_PMAIP1-      ------
H2NWG2_PMAIP1-01        ------
A0A2K5CFK7_PMAIP1-      ------
F7GW45_PMAIP1-01        ------
A0A337SUX1_PMAIP1-      ------
W5P738_PMAIP1-01        ------
A0A287AZR7_PMAIP1-      ------
G1MV54_BCL2L11-01       ------
G1PDJ5_BCL2L11-01       ------
K7E5Y2_BBC3-01          ------
F6RS78_BIK-01           ------
B2KKY9_BCL2L11-01       ------
B8JK68_BCL2L11-01       ------
A0A2K6KS56_BBC3-02      ------
F7G1G0_HRK-01           ------
A0A1U7R468_HRK-01       ------
P62816_HRK-03           ------
P62817_HRK-01           ------
A0A287A5N9_HRK-01       ------
H2NIS8_HRK-01           ------
A0A2K5KZ69_HRK-01       ------
H2Q6Y8_HRK-01           ------
G3UH24_HRK-01           ------
A0A2K5BYA0_HRK-01       ------
G3MWR6_HRK-01           ------
U3E722_HRK-01           ------
A0A0D9SC73_HRK-01       ------
A0A337SQ56_HRK-01       ------
G3QTJ6_HRK-01           ------
O00198_HRK-01           ------
A0A1D5R1E4_HRK-01       ------
A0A2K6AYL7_HRK-01       ------
G1QHD8_HRK-01           ------
G1T7W1_HRK-01           ------
H0Y001_HRK-01           ------
A0A096N944_HRK-01       ------
A0A2K6GL98_HRK-01       ------
E2RLD4_HRK-01           ------
F7GVS7_BAD-04           ------
Q2PG01_BAD-01           ------
A0A2I3H4B2_BAD-01       ------
K7GA86_BCL2L11-01       ------
G3SU55_BCL2L11-01       ------
G3W979_BCL2L11-01       ------
O43521_BCL2L11-11       ------
F7HHA9_BCL2L11-08       ------
A0A1U8BW10_BCL2L11      ------
O54918_BCL2L11-03       ------
O43521_BCL2L11-19       ------
O43521_BCL2L11-07       ------
A0A2I3HW02_BCL2L11      ------
A0A2K6TRZ5_BCL2L11      ------
A0A2K5HZI7_BCL2L11      ------
A0A2K5NU92_BCL2L11      ------
A0A2K5Z8B6_BCL2L11      ------
A0A2I2YQ13_BCL2L11      ------
O43521_BCL2L11-23       ------
A0A2R9CA99_BCL2L11      ------
A0A2J8JCT2_BCL2L11      ------
F7HHA9_BCL2L11-07       ------
A0A2K5CAB2_BCL2L11      ------
A0A2K5X2I7_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
C1KGB8_BCL2L11-01       ------
A0A2K6GE31_BCL2L11      ------
A0A337SW42_BCL2L11      ------
O43521_BCL2L11-10       ------
O43521_BCL2L11-20       ------
A0A2I2YQ13_BCL2L11      ------
O43521_BCL2L11-17       ------
O43521_BCL2L11-13       ------
A0A2I3HW02_BCL2L11      ------
A0A2R9CA99_BCL2L11      ------
A0A2J8JCT2_BCL2L11      ------
A0A2K5NU92_BCL2L11      ------
A0A2K5X2I7_BCL2L11      ------
F7HHA9_BCL2L11-05       ------
A0A2K5Z8B6_BCL2L11      ------
A0A2K5HZI7_BCL2L11      ------
A0A2K6KJP8_BCL2L11      ------
A0A2K6QIL2_BCL2L11      ------
A0A2K5CAB2_BCL2L11      ------
A0A2K5Z8B6_BCL2L11      ------
A0A2K6KJP8_BCL2L11      ------
A0A2K6QIL2_BCL2L11      ------
F6XMC1_BCL2L11-09       ------
A0A2K6TRZ5_BCL2L11      ------
A0A2K5HZI7_BCL2L11      ------
A0A2R9CA99_BCL2L11      ------
A0A2J8JCT2_BCL2L11      ------
A0A2K5NU92_BCL2L11      ------
A0A2K5X2I7_BCL2L11      ------
F7HHA9_BCL2L11-09       ------
A0A2K6E226_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2I2YQ13_BCL2L11      ------
O43521_BCL2L11-06       ------
O43521_BCL2L11-15       ------
A0A2I3HW02_BCL2L11      ------
F1SU81_BCL2L11-03       ------
A0A0D9RWE0_BCL2L11      ------
O43521_BCL2L11-05       ------
O43521_BCL2L11-25       ------
O54918_BCL2L11-08       ------
O54918_BCL2L11-06       ------
A0A1U8BW10_BCL2L11      ------
Q2YDF0_BCL2L11-01       ------
A0A287DFJ0_BCL2L11      ------
O54918_BCL2L11-05       ------
O88498_BCL2L11-02       ------
A0A2K6GE31_BCL2L11      ------
A0A2K5CAB2_BCL2L11      ------
A0A2K6TRZ5_BCL2L11      ------
A0A2K6QIL2_BCL2L11      ------
A0A2K5NU92_BCL2L11      ------
A0A2K5HZI7_BCL2L11      ------
A0A2K5X2I7_BCL2L11      ------
A0A2K6E226_BCL2L11      ------
A0A2K5Z8B6_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2K6KJP8_BCL2L11      ------
A0A2I2YQ13_BCL2L11      ------
O43521_BCL2L11-02       ------
A0A2R9CA99_BCL2L11      ------
A0A2J8JCT2_BCL2L11      ------
H2P5E2_BCL2L11-01       ------
A0A337SW42_BCL2L11      ------
A0A286XJN2_BCL2L11      ------
A0A1S3FHA8_BCL2L11      ------
Q4KMV9_BCL2L11-01       ------
F7FTC8_BCL2L11-01       ------
A0A2K6E226_BCL2L11      ------
M3YDI3_BCL2L11-01       ------
F6XMC1_BCL2L11-02       VA----
F6XMC1_BCL2L11-01       VA----
F7CXT2_BCL2L11-01       ------
F6XMC1_BCL2L11-08       ------
A0A337SW42_BCL2L11      ------
A0A337SW42_BCL2L11      ------
A0A2K6GE31_BCL2L11      ------
A0A2K6GE31_BCL2L11      ------
A0A2K5NU92_BCL2L11      ------
A0A2K5HZI7_BCL2L11      ------
A0A2I2YQ13_BCL2L11      ------
O43521_BCL2L11-08       ------
O43521_BCL2L11-22       ------
A0A2K5X2I7_BCL2L11      ------
F7HHA9_BCL2L11-03       ------
A0A2K6E226_BCL2L11      ------
A0A2K5Z8B6_BCL2L11      ------
A0A2I3HW02_BCL2L11      ------
A0A2R9CA99_BCL2L11      ------
A0A2J8JCT2_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2K6KJP8_BCL2L11      ------
A0A2K6QIL2_BCL2L11      ------
A0A2K5CAB2_BCL2L11      ------
F6XMC1_BCL2L11-06       ------
A0A2K6TRZ5_BCL2L11      ------
A0A2K5CAB2_BCL2L11      ------
A0A2K6TRZ5_BCL2L11      ------
A0A2K5CAB2_BCL2L11      ------
F6XMC1_BCL2L11-04       ------
A0A2K6TRZ5_BCL2L11      ------
A0A2K5NU92_BCL2L11      ------
A0A2I2YQ13_BCL2L11      ------
O43521_BCL2L11-21       ------
A0A2K5X2I7_BCL2L11      ------
F7HHA9_BCL2L11-01       ------
A0A2K6E226_BCL2L11      ------
A0A2K5Z8B6_BCL2L11      ------
A0A2I3HW02_BCL2L11      ------
A0A2R9CA99_BCL2L11      ------
A0A2J8JCT2_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2K6KJP8_BCL2L11      ------
A0A2K6QIL2_BCL2L11      ------
A0A2K5NU92_BCL2L11      ------
A0A2K5HZI7_BCL2L11      ------
A0A2I2YQ13_BCL2L11      ------
O43521_BCL2L11-24       ------
O43521_BCL2L11-12       ------
A0A2K5X2I7_BCL2L11      ------
F7HHA9_BCL2L11-06       ------
A0A2K6E226_BCL2L11      ------
A0A2K5Z8B6_BCL2L11      ------
A0A2I3HW02_BCL2L11      ------
A0A2R9CA99_BCL2L11      ------
A0A2J8JCT2_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2K6KJP8_BCL2L11      ------
A0A2K6QIL2_BCL2L11      ------
A0A2K5HZI7_BCL2L11      ------
O54918_BCL2L11-01       ------
O88498_BCL2L11-01       ------
A0A1U8BW10_BCL2L11      ------
A0A287DFJ0_BCL2L11      ------
A0A2K6GE31_BCL2L11      ------
A0A2K6GE31_BCL2L11      ------
A0A2K5CAB2_BCL2L11      ------
F6XMC1_BCL2L11-07       ------
A0A2K6TRZ5_BCL2L11      ------
F6XMC1_BCL2L11-05       ------
A0A2K6TRZ5_BCL2L11      ------
A0A2K5CAB2_BCL2L11      ------
A0A2K5NU92_BCL2L11      ------
A0A2K5HZI7_BCL2L11      ------
A0A2K5X2I7_BCL2L11      ------
F7HHA9_BCL2L11-02       ------
A0A2K6E226_BCL2L11      ------
A0A2K5Z8B6_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2K6KJP8_BCL2L11      ------
A0A2K6QIL2_BCL2L11      ------
A0A2I2YQ13_BCL2L11      ------
O43521_BCL2L11-16       ------
O43521_BCL2L11-09       ------
A0A2R9CA99_BCL2L11      ------
A0A2J8JCT2_BCL2L11      ------
A0A2K5NU92_BCL2L11      ------
A0A2K5HZI7_BCL2L11      ------
A0A2K5X2I7_BCL2L11      ------
F7HHA9_BCL2L11-04       ------
A0A2K6E226_BCL2L11      ------
A0A2K5Z8B6_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2K6KJP8_BCL2L11      ------
A0A2K6QIL2_BCL2L11      ------
A0A2I2YQ13_BCL2L11      ------
O43521_BCL2L11-18       ------
A0A2I3HW02_BCL2L11      ------
A0A2R9CA99_BCL2L11      ------
A0A2J8JCT2_BCL2L11      ------
A0A2K5CAB2_BCL2L11      ------
A0A2K5CAB2_BCL2L11      ------
F6XMC1_BCL2L11-03       ------
A0A2K6TRZ5_BCL2L11      ------
A0A2K6TRZ5_BCL2L11      ------
A0A2K6QIL2_BCL2L11      ------
A0A2K6QIL2_BCL2L11      ------
A0A2K5NU92_BCL2L11      ------
A0A2K5HZI7_BCL2L11      ------
A0A2K5X2I7_BCL2L11      ------
A0A2K6E226_BCL2L11      ------
A0A2K6E226_BCL2L11      ------
A0A2K5Z8B6_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2K6KJP8_BCL2L11      ------
A0A2K6KJP8_BCL2L11      ------
A0A2I2YQ13_BCL2L11      ------
O43521_BCL2L11-03       ------
A0A2I3HW02_BCL2L11      ------
A0A2R9CA99_BCL2L11      ------
A0A2J8JCT2_BCL2L11      ------
F1SU81_BCL2L11-02       ------
A0A337SW42_BCL2L11      ------
W5PY58_BCL2L11-01       ------
F7A7D2_BCL2L11-01       ------
A0A286XJN2_BCL2L11      ------
A0A286XJN2_BCL2L11      ------
G1SSY0_BCL2L11-01       ------
H0XW23_BCL2L11-01       ------
A0A1S3FHA8_BCL2L11      ------
A0A337SW42_BCL2L11      ------
G1LDR8_BCL2L11-01       ------
J9NWV6_BCL2L11-01       ------
F1SU81_BCL2L11-01       ------
A0A286XF37_PMAIP1-      ------
A0A1U7QLK6_PMAIP1-      ------
Q9JM54_PMAIP1-01        ------
Q5U777_PMAIP1-01        ------
I3LVX0_BIK-01           ------
A9XRH0_BMF-01           ------
R4G9R5_BCL2L11-01       ------
Q6P7C5_BAD-01           ------
A0A287AEF3_BAD-02       ------
O61667_EGL1-01          ------
A3KND0_BMF-01           ------
A0A2K5F6X4_BBC3-02      ------
A0A337SQV0_BBC3-03      ------
F1SMU1_PMAIP1-01        ------
Q9BXH1_BBC3-04          ------
K7E5Y2_BBC3-02          ------
F7CQN5_BBC3-01          ------
A0A2I3HWI8_BBC3-03      ------
A0A2K6FQZ3_BBC3-04      ------
Q9BXH1_BBC3-05          ------
A0A2R9BZA9_BBC3-01      ------
A0A2I3RGH5_BBC3-03      ------
A0A2K5P2T8_BBC3-03      ------
A0A2K5V8J3_BBC3-03      ------
F7FFP6_BBC3-03          ------
A0A2K6ASP2_BBC3-03      ------
A0A2I3N2Z9_BBC3-03      ------
A0A2K6QZU4_BBC3-04      ------
A0A2R8MW85_BBC3-03      ------
A0A2K6STD6_BBC3-02      ------
G3T2N1_BBC3-01          ------
M3Y0R3_BBC3-01          ------
A0A1U7R5N5_BBC3-01      ------
Q99ML1_BBC3-02          ------
Q80ZG6_BBC3-01          ------
H0XQ00_BBC3-01          ------
J9NTK9_BBC3-01          ------
A0A337SQV0_BBC3-02      ------
F1RM01_BBC3-01          ------
A0A2K6FQZ3_BBC3-01      ------
Q9BXH1_BBC3-06          ------
A0A2I3RIG5_BBC3-02      ------
H2NZD3_BBC3-01          ------
A0A2K6QZU4_BBC3-01      ------
A0A0D9S2H2_BBC3-01      ------
B4DQK3_BBC3-01          ------
F6TGJ4_BMF-01           ------
G1PAU1_BMF-01           ------
A0A1U8CPE0_BMF-02       ------
A0A286XXB0_BMF-03       ------
I3MDS9_BMF-02           ------
A0A287AIU8_BMF-05       ------
A0A287AIU8_BMF-03       ------
A0A287AIU8_BMF-01       ------
A0A287AIU8_BMF-02       ------
A0A287AIU8_BMF-04       ------
A0A1S3EQA2_BMF-02       ------
A2AV74_BMF-02           ------
A0A337SQV0_BBC3-01      ------
Q9BXH1_BBC3-03          ------
A0A2K5KGR6_BMF-01       ------
A0A2K6FFR1_BMF-02       ------
M3WRS0_BMF-02           ------
A0A2K5E1W9_BMF-02       ------
F7HPK0_BMF-02           ------
A0A2K6TW86_BMF-03       ------
A0A2K6RAW8_BMF-02       ------
G3QIN5_BMF-02           ------
Q96LC9_BMF-07           ------
Q96LC9_BMF-05           ------
A0A2R9BS98_BMF-02       ------
A0A2J8QDD5_BMF-01       ------
A0A2K5MJY6_BMF-01       ------
G7PAW6_BMF-01           ------
A0A2K6B5G4_BMF-03       ------
A0A2K5Z4C3_BMF-02       ------
A0A096NTE9_BMF-03       ------
A0A2I3HD83_BMF-01       ------
A0A1S3EQA2_BMF-01       ------
Q8K589_BMF-01           ------
A2AV74_BMF-01           ------
I3MDS9_BMF-01           ------
G3T7Z4_BMF-01           ------
F6X3N6_BMF-01           ------
G3WDQ2_BMF-01           ------
A0A1S3WU31_BMF-01       ------
Q96LC9_BMF-06           ------
A0A286XXB0_BMF-02       ------
J9PB65_BMF-01           ------
A0A1U8CPE0_BMF-01       ------
A0A286XXB0_BMF-01       ------
G1SR62_BMF-01           ------
F6TJI0_BMF-01           ------
Q05KI3_BMF-01           ------
W5QFV1_BMF-01           ------
M3WRS0_BMF-01           ------
M3YAD5_BMF-01           ------
A0A2K6FFR1_BMF-01       ------
H0WYH6_BMF-01           ------
A0A096NTE9_BMF-01       ------
A0A2K6L933_BMF-02       ------
A0A096NTE9_BMF-02       ------
A0A2K5MJY6_BMF-02       ------
A0A2K5KGR6_BMF-02       ------
G7PAW6_BMF-02           ------
F7CM09_BMF-02           ------
A0A2K6B5G4_BMF-02       ------
A0A2K6B5G4_BMF-01       ------
A0A2K6B5G4_BMF-04       ------
A0A2K5Z4C3_BMF-01       ------
A0A2K6L933_BMF-03       ------
A0A2K6L933_BMF-01       ------
A0A2K6RAW8_BMF-01       ------
A0A0D9R4R5_BMF-01       ------
F7HPK0_BMF-01           ------
A0A2K5E1W9_BMF-01       ------
A0A2K6TW86_BMF-02       ------
A0A2K6TW86_BMF-01       ------
G3QIN5_BMF-01           ------
Q96LC9_BMF-01           ------
Q96LC9_BMF-02           ------
Q96LC9_BMF-03           ------
Q96LC9_BMF-04           ------
A0A2R9BS98_BMF-01       ------
A0A2J8QDD5_BMF-02       ------
A0A2J8T301_BMF-01       ------
H9GL49_BMF-01           ------
A9XRG9_BMF-01           ------
K7FRX2_BMF-01           ------
U3JS06_BMF-01           ------
H0ZMX5_BMF-01           ------
A9XRG9_BMF-02           ------
A9XRG9_BMF-03           ------
G1NHG8_BMF-01           ------
W5N4P7_BMF-01           ------
I3K2D6_BMF-01           ------
A0A096LRV0_BMF-01       ------
A0A2U9CJH3_BMF-01       PCALIG
Q0GKC7_BMF-01           ------
A0A2K5JY52_PMAIP1-      ------
A0A096MPU8_PMAIP1-      ------
A0A2K5ZWH1_PMAIP1-      ------
A0A2K5VPX2_PMAIP1-      ------
A0A2K6BV75_PMAIP1-      ------
A0A2K6KJF2_PMAIP1-      ------
A0A2K6NC45_PMAIP1-      ------
Q13794_PMAIP1-02        ------
A0A2R9AKC9_PMAIP1-      ------
A0A1D5QGJ8_PMAIP1-      ------
A0A2I2YVQ5_PMAIP1-      ------
A0A2I3SX38_PMAIP1-      ------
C1C3S9_BAD-01           ------
F6Z067_BAD-01           ------
M3XHJ5_BCL2L11-01       ------
W5QCU2_BIK-01           ------
O70337_BIK-04           ------
O70337_BIK-02           ------
O70337_BIK-01           ------
Q925D2_BIK-01           ------
G1TZR9_BIK-01           ------
F1PUF4_BIK-01           ------
H0XAE7_BIK-01           ------
A0A2K6FM79_BIK-01       ------
A0A1S3FUQ7_BIK-01       ------
H0W025_BIK-01           ------
A0A2K5CLG5_BIK-01       ------
F7FUT7_BIK-01           ------
A0A2K6TBD7_BIK-01       ------
H2P4N6_BIK-01           ------
G1S1X2_BIK-01           ------
G3QCT2_BIK-01           ------
A0A2R8ZXD2_BIK-01       ------
H2QLU7_BIK-01           ------
Q13323_BIK-01           ------
A0A2K6MCW0_BIK-01       ------
A0A2K6QK74_BIK-01       ------
A0A0D9QZY8_BIK-01       ------
A0A2K5VW94_BIK-01       ------
A0A2K6DBJ4_BIK-01       ------
A0A2K5J4Q7_BIK-01       ------
A0A096NKG5_BIK-01       ------
A0A2K5LDM6_BIK-01       ------
A0A2K5XSA1_BIK-01       ------
I3K7B6_BAD-01           ------
B5X1T1_BAD-01           ------
Q4V925_BAD-02           ------
Q4V925_BAD-03           ------
A7MCM4_BAD-01           ------
Q4V925_BAD-04           ------
Q4V925_BAD-01           ------
G3Q8B3_BAD-01           ------
A0A087X8P8_BAD-01       ------
E7FBJ6_BAD-01           ------
B5XEF1_BAD-01           ------
G1SS60_BAD-01           ------
Q9GL49_PMAIP1-01        ------
H3D8J8_BAD-01           ------
H3ANP3_BAD-03           ------
H3ANP3_BAD-04           ------
H3ANP3_BAD-01           ------
H3ANP3_BAD-02           ------
A0A337SAW2_BAD-01       ------
A0A2U9BAC9_BAD-01       ------
A0A2I3TBK7_BAD-01       ------
A0A2R8Z697_BAD-02       ------
A0A2I2Z8C7_BAD-03       ------
Q92934_BAD-03           ------
A0A2K5M0C1_BAD-02       ------
A0A2K5XJR2_BAD-02       ------
A0A2I3MCN5_BAD-03       ------
A0A2K5VCD8_BAD-02       ------
F7GVS7_BAD-02           ------
A0A2K6E7J3_BAD-02       ------
A0A2K5E6K7_BAD-02       ------
A0A2K6TG62_BAD-02       ------
A0A2K5E6K7_BAD-03       ------
A0A2K5HKW9_BAD-02       ------
A0A2K6N1A1_BAD-02       ------
A0A2K6PUM5_BAD-02       ------
A0A2K5M0C1_BAD-03       ------
A0A2K5VCD8_BAD-03       ------
F7GVS7_BAD-03           ------
A0A2K5XJR2_BAD-03       ------
A0A2I3MCN5_BAD-02       ------
A0A2K6E7J3_BAD-03       ------
A0A2I2Z8C7_BAD-04       ------
Q92934_BAD-04           ------
A0A2I3TBK7_BAD-03       ------
A0A2R8Z697_BAD-03       ------
F6SJL0_BAD-02           ------
A0A2K6TG62_BAD-03       ------
G1P8C5_BAD-01           ------
W5P8G9_BAD-01           ------
G3VRY4_BAD-01           ------
G3VRY4_BAD-02           ------
G3TP47_BAD-01           ------
I3MBM5_BAD-01           ------
I3MBM5_BAD-02           ------
A0A091DDU4_BAD-01       ------
Q61337_BAD-02           ------
Q61337_BAD-03           ------
A0A1U7Q4V0_BAD-01       ------
Q61337_BAD-01           ------
G1MI17_BAD-01           ------
A0A287AEF3_BAD-01       ------
O35147_BAD-01           ------
M3YNE7_BAD-01           ------
F1MUT9_BAD-01           ------
Q3SYZ0_BAD-01           ------
F7DN67_BAD-01           ------
H0WVR2_BAD-01           ------
H0V608_BAD-01           ------
A0A1S3FL84_BAD-01       ------
A0A2K5E6K7_BAD-01       ------
A0A2K6TG62_BAD-01       ------
A0A0D9R491_BAD-01       ------
A0A2K5M0C1_BAD-01       ------
A0A2K5VCD8_BAD-01       ------
F7GVS7_BAD-01           ------
A0A2K6E7J3_BAD-01       ------
A0A2K5XJR2_BAD-01       ------
A0A2I3MCN5_BAD-04       ------
A0A2K6N1A1_BAD-01       ------
A0A2K6PUM5_BAD-01       ------
A0A2K5HKW9_BAD-01       ------
B4DZQ9_BAD-01           ------
A0A2K6GWV0_BAD-01       ------
F6SJL0_BAD-01           ------
A0A2I3MCN5_BAD-01       ------
A0A2I2Z8C7_BAD-01       ------
A0A2I2Z8C7_BAD-02       ------
Q92934_BAD-01           ------
Q92934_BAD-02           ------
A0A2I3TBK7_BAD-02       ------
A0A2R8Z697_BAD-01       ------
A0A2J8TYJ3_BAD-01       ------
F1PK10_BAD-01           ------
Q45KI9_BAD-01           ------
                              

© 1998-2018